(data stored in ACNUC7421 zone)

EMBL: CP000820.PE297

CP000820.PE297       Location/Qualifiers
FT   CDS_pept        complement(354886..356019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09766"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:A8LE01"
FT                   /protein_id="ABW09766.1"
FT                   /translation="MDAELVDWELAVTTAKKLVRPGPQRSRAEADEIVSELRRLAVVAE
FT                   GHVQDYTQLVPAGPPTPIAVVDRPEWVRSNVAGLRVATMPLIEKLSDQSRGRLAAAVGR
FT                   RVTGVQVGSALAYLAGKVLGQFEVFLPPEEYEAGSAASAPSLAKPGAPTPVGRLSLVAP
FT                   NIAHAEETLRVVPRDFRLWVCLHEQTHRSQFTAVPWLREHLESEIAAFIGATDLDPDVL
FT                   ADRLRSAVTALRSAVRDHGPDTPSVVEALQTPAQRAVLDRLQALMSLLEGHADQVMDAV
FT                   GPQVVPTVADIRGKFDNRRSGGSPIDRFLRRLLGLDLKMQQYRQGGAFVRAVVAEVGVE
FT                   GFNHVWQSPRTLPTRPELTDPGAWMLRVLGTRPSMSA"
     gtggacgctg agctggtgga ctgggaactc gccgtaacga cggcgaagaa gctcgtccga        60
     ccagggccgc agcgaagccg ggcggaggcg gacgagatcg tctcggagct ccggcgcctg       120
     gcggtcgtcg ccgagggcca tgtgcaggac tacacccagc tcgtccccgc cggaccaccg       180
     accccgatcg cggtcgtcga ccggccggag tgggttcgtt ccaacgtcgc cgggctgcgc       240
     gtggccacca tgcccctgat cgagaagctc tccgaccaga gccgcggccg gctcgccgcc       300
     gcggtgggcc ggcgggtcac cggtgtccag gtcgggtccg cgctcgccta cctcgcgggc       360
     aaggtcctcg gccagttcga ggtcttcctc ccgccggagg agtacgaggc gggcagcgcc       420
     gcgagcgccc cgtctctggc gaagcccggc gctccgaccc cggtggggcg gctcagcctc       480
     gtcgcgccga acatcgccca cgccgaggag accctgcggg tggtcccacg cgacttccgg       540
     ctctgggtct gcctgcacga gcagacgcac cgcagccagt tcaccgccgt cccgtggctg       600
     cgcgagcacc tcgagtccga gatcgcggcg ttcatcggcg cgaccgacct cgatcccgat       660
     gtcctcgccg accggctccg ctccgccgtc acggcgctgc gcagcgccgt gcgcgaccac       720
     gggccggaca cgccgagcgt cgtggaggcg ttgcagaccc cggcgcaacg cgccgtcctc       780
     gaccgcctcc aggcgctgat gagcctgctc gaggggcacg ccgaccaggt catggacgcg       840
     gtcggcccgc aggtcgtgcc gacggtggcc gacatccgcg gcaagttcga caaccggcgc       900
     tccggcggct cgcccatcga ccgcttccta cgtcgcctgc tcgggctgga tctcaagatg       960
     cagcagtacc gccagggcgg ggcgttcgtc cgcgccgtgg tcgccgaggt cggcgtggag      1020
     ggcttcaacc acgtctggca gtcgccgcgg accctgccca cccgccctga gctgaccgac      1080
     ccgggcgcgt ggatgctccg ggtgctcggc acccgcccgt cgatgtccgc gtga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page