(data stored in ACNUC7421 zone)

EMBL: CP000820.PE298

CP000820.PE298       Location/Qualifiers
FT   CDS_pept        complement(356152..357639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0301"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /note="TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C; KEGG:
FT                   fal:FRAAL6585 conserved hypothetical protein; putative
FT                   signal peptide; putative penicillin-binding protein 6
FT                   [precursor] (D-alanyl-D-alanine carboxypeptidase fraction C
FT                   (DacC)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09767"
FT                   /db_xref="GOA:A8LF22"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF22"
FT                   /protein_id="ABW09767.1"
FT                   /translation="MPLGARAGGLTALAGALLAGSLSPGPAAPPGGASPAPPGVRAEAS
FT                   ALPGLDPDAPKADPAAVAARLLGPLSDPVLGGPATLVVDALTGQVLFANRPTEPTAPAS
FT                   TVKIATATAALTALDPDARLRTRAVYLPPASAPPAATAGSPAATTGSAAAPGRAPLAPG
FT                   GTLWLVGAGDPTLTAATGAAGYPPAARLSDLAEQVRKAGITAVGSVVGDGTAYEGPGMA
FT                   PGWRDGYVTDGNVTPVSALSVDAGRAAPGSAGPRSLTPDAAAAAAFGTALTAAGVSVGS
FT                   VSTGRADAAAREVGSVQSPPIPVLVERMLTDSDNDLAESLGRQVAIARGLPASFDGATR
FT                   GVLGALRDAGIPTDGASLRDTSGLSIDNRIAPATLVAALRTAALPGHPALRTVLSGLPV
FT                   AGFTGTLGDRYGPGDTSPGAGVVRAKTGSLRIVTSLAGMVTDSDGRLLLFGLFAPVEEQ
FT                   GLTKMALDRVAAALASCGCPPAGAGPPSAGPPVPPGG"
     gtgccgctgg gcgcgcgggc cggtggcctc acggcactgg ccggagcgct gctcgccgga        60
     tcgctctcgc ccggtccggc ggcgcctccg ggcggcgcgt caccggcccc gccgggtgta       120
     cgcgccgagg cgtccgcgct gccggggctg gacccggacg cgccgaaggc cgacccggcc       180
     gcggtggccg cgcggctgct cgggccgctc tccgaccccg tgctgggcgg ccctgccacg       240
     ctggtggtcg acgcgctgac cgggcaggtg ctttttgcga accgccccac cgagccgacc       300
     gctcccgcat ccacggtcaa gatcgccacg gcgaccgcgg cactcaccgc gctcgatccg       360
     gacgcccgcc tgcgcacccg cgcggtctac ctcccgccgg ccagcgcgcc acccgcggcg       420
     accgcagggt cacctgcggc aaccaccggg tcggcggctg cgcccggccg ggcgcccctg       480
     gccccaggcg gcacgctctg gctggtcggc gcgggcgatc cgaccctgac cgcggcgacc       540
     ggggcggccg ggtacccgcc ggcggcccgg ttgagcgacc tcgccgagca ggtccgcaag       600
     gccggcatca ccgctgtcgg ctcggtggtc ggcgacggga cggcctacga gggcccgggg       660
     atggcgcccg gctggcgcga cggctacgtg accgacggga acgtgacccc ggtgtccgcg       720
     ctgtcggtcg acgctggccg cgcggcgccc ggctccgccg ggccgcgcag cctgaccccg       780
     gacgccgccg cggcggccgc gttcggcacg gccctcaccg cggccggcgt gtccgtcggc       840
     tcggtctcga cgggccgggc ggacgcggcg gcccgcgagg tcgggtccgt gcagagcccg       900
     ccgatcccgg tcctggtcga gcggatgctc accgactccg acaacgacct ggcggaaagc       960
     ctgggacgtc aggtcgcgat cgcccggggg cttccggcga gcttcgacgg ggccacccgg      1020
     ggcgtgctcg gcgcccttcg cgacgcgggc atcccgaccg acggcgcctc gctgcgcgac      1080
     accagcggac tttcgatcga caaccggatc gccccggcga cgctcgtcgc ggcgctgcgg      1140
     acggccgccc tgccgggtca tccggccctg cggacggtcc tgtccgggct gccggtcgcg      1200
     ggcttcaccg gcacgctcgg cgaccggtac ggccccggcg acacctcgcc gggggccggc      1260
     gtcgtccggg cgaagaccgg cagcctgcgc atcgtgacca gcctcgccgg catggtgacc      1320
     gacagcgacg gacggctgtt gctgttcggg ctgttcgccc cggtcgagga gcagggcctg      1380
     accaagatgg cgctggaccg ggtcgcggcg gccctcgcct cctgcggatg tccgccggcc      1440
     ggcgccgggc cgccatcagc cgggccaccg gtgccgccgg gcggctag                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page