(data stored in ACNUC7421 zone)

EMBL: CP000820.PE3

CP000820.PE3         Location/Qualifiers
FT   CDS_pept        3956..5116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0003"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: fal:FRAAL0004 DNA polymerase III, beta chain;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09472"
FT                   /db_xref="GOA:A8LB18"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB18"
FT                   /protein_id="ABW09472.1"
FT                   /translation="MRFRVERDEFTDAVAWTARTLPSRATTQLQVLAGLLLDATGPALK
FT                   VAAFDYEVAAQGELDATVTEEGRGLVNGKMLADITRSLPAAPVDVHVDGTRLVVACGNA
FT                   RFALPMLPVDDYPTLPPMPEITGHIEGAAFGSAVAQVAVAAGRDDTLPVLTGVRLEIDG
FT                   DTLTLAATDRYRLAVRTLKWRPATPDASGVALVPARTLLDTAKSLSGSGVEVAVALGTG
FT                   PSGETLAGFAGNTRQTTTRLLEGTFPPYRKLLPDSSPLIAQLEIAPLTEAVKRVALVAA
FT                   RTAPVQLTFTPDHLVLEAGTGGEAQASETLPVTYDGPELTVAFNPAYLLDALGALESDI
FT                   VRIGFASAEDAALAASKPAILTGKGGDDQTEIPDYRYLLMPIRLNG"
     atgaggttcc gcgtggaacg ggacgaattc accgacgcgg tggcctggac ggcccgcacc        60
     ctgccgagcc gggcgaccac gcagttgcag gtcctggccg gcctgctgct cgacgccacc       120
     ggtccggcgc tcaaggtcgc cgcgttcgac tacgaggtcg ccgcgcaggg tgagctggac       180
     gccaccgtca ccgaagaggg ccggggcctg gtcaacggca agatgctcgc ggacatcacc       240
     cgctccctgc ccgcggcgcc ggtcgacgtc cacgttgacg gcacccgcct cgtcgtcgcc       300
     tgcggcaacg cccggttcgc actaccgatg ctgcccgtcg acgactaccc gaccctgccg       360
     ccgatgccgg agatcaccgg gcacatcgag ggcgccgcgt tcggcagtgc cgtcgcgcag       420
     gtcgccgtag ccgcgggccg tgacgacacc ctgccggtcc tcaccggcgt gcgtctcgag       480
     atcgacggcg acacgctcac cctcgccgct accgaccgtt accgcctcgc cgtgcgcacg       540
     ctcaagtggc gccctgcgac ccccgatgcg tccggcgtcg cgctcgtccc ggcccgcacc       600
     ctgctcgaca cggcgaagag cctgtccggc tcgggcgtcg aggtcgccgt cgcgctcggc       660
     accggtccct ccggggagac gctcgccggt ttcgccggca acacccgcca gaccaccacg       720
     cgtctgctcg agggcacctt cccgccctac cgcaagttgc tgcccgacag ctcaccgctg       780
     atcgcccagc tcgagatagc tcccctcacc gaggcggtca agcgcgtcgc gctcgtcgcg       840
     gcccgcaccg ccccggtgca gctgacgttc acccccgacc acctcgtcct cgaggcaggt       900
     accggcggcg aggcccaggc gtccgagact ctgcccgtca cctatgacgg gcctgagctc       960
     acggtcgcct tcaaccccgc ctacctgctc gacgccctcg gcgcgctcga gtccgacatc      1020
     gtccggatcg ggttcgccag cgccgaggac gccgcgcttg ccgcgagcaa gcccgcgatc      1080
     ctcaccggca agggcggcga cgaccagacc gagatccccg actaccgcta cctgctgatg      1140
     ccgatccgac tcaacgggtg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page