(data stored in ACNUC7421 zone)

EMBL: CP000820.PE30

CP000820.PE30        Location/Qualifiers
FT   CDS_pept        complement(39584..40471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09499"
FT                   /db_xref="GOA:A8LB38"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB38"
FT                   /protein_id="ABW09499.1"
FT                   /translation="MASSRPTSKSVRSGRPTGRATTGSAEEDLLIVHRHQDHPEGRRRL
FT                   SRAETTVLAEARVRPGQDLVDLSQASTLTPAALWAVVPGGSVTTLTPTAVALQRIRPTP
FT                   ENGHTWGSVWDLLEHPVPLADASVDAVIGRSVLGPLRHPRRMLTDIARVLKPGGWLSLC
FT                   EPLLGQSRPVSLDGLSAHEIAQAEQVLAGVRPAAHAFTAAHAVGNARLAGLRPVEHTEE
FT                   TVTAPIIGVAAADAALRAVGPAGESAYQAISRVLGAAFARQYAEAWRSTARRRPLILET
FT                   PIAYLTMIKRETSR"
     atggcttcct cccgtcccac ctccaaatcc gtgcggagcg gccggcccac gggccgggcg        60
     accaccggat ccgccgagga ggatcttctg atcgtgcacc ggcaccaaga ccatcccgag       120
     ggccggcgcc ggctgtcgcg ggccgagacc acggtcctcg ccgaggcgcg ggtccgtcca       180
     ggccaagatc tggtcgacct cagccaggca tcgaccctga cacctgccgc gctctgggcc       240
     gtcgtccccg gcggcagcgt caccaccctc accccgaccg ccgtcgcgct gcagcggata       300
     cggccgaccc cggagaacgg ccacacctgg ggatcggtct gggacttact cgaacacccc       360
     gtacccctgg cggacgccag tgtcgacgcg gtcatcggcc gcagcgtcct cggcccgctc       420
     cgccaccccc gtcggatgct gaccgacatc gcccgcgtcc tcaaacccgg aggatggctg       480
     tcgctgtgcg agcccctgct cgggcagagc agacccgtca gcctcgacgg gctcagcgca       540
     cacgagatcg cccaggccga acaggtcctc gcgggcgtgc gccccgccgc ccacgccttc       600
     accgcggcgc atgcggtcgg caacgcccgc ctcgccggcc tccgcccggt cgaacacacc       660
     gaagagacgg tcaccgcccc catcatcgga gtcgccgccg ccgacgccgc gctgcgcgct       720
     gtaggcccgg cgggagaatc cgcctaccag gcgatcagcc gcgtcctcgg cgccgcgttc       780
     gcccgccagt acgccgaagc atggcgctcg accgcccgcc gacgccccct catcctggaa       840
     acccccatcg cctacctcac catgatcaaa cgggagacga gcagataa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page