(data stored in ACNUC7421 zone)

EMBL: CP000820.PE304

CP000820.PE304       Location/Qualifiers
FT   CDS_pept        complement(363151..364407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0307"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: fal:FRAAL6581 DNA polymerase III delta'
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09773"
FT                   /db_xref="GOA:A8LF28"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF28"
FT                   /protein_id="ABW09773.1"
FT                   /translation="MHDNDGVTVWDTLVGQDAVVATLTAAATAAALVTEGGSLAAARAG
FT                   MTHSWLFTGPAGSGLADAARAFAAGLLCENIPPGCGQCPGCHTVLSDTAADLRTVRPEG
FT                   LSIGVRDVRALIRDAASAPSAGRWRILLIEDADRFTDSAANALLKALEEPAERAVFLLC
FT                   APSVDDVLPTIRSRCRSVALRLPNPKNVADVLIREGTAEDLAAVLAQASQGHVGQARRL
FT                   ATDPQARARRESVLRLPSRLRRVGDCLAAAADLVDAANADAQAANAERDEVETEALKTA
FT                   LGVGATSSGTRSTSARGAKAGAKPRSLQVRGAAGALKELERTQKSRGRRTVLDSLDRAL
FT                   VDLAGLYRDVLVQQLRGQVTPVHLDQADAVAQLAAAATPEQTLRRWEAVLATRQALADN
FT                   PGLVPQLAAESLALTLRDA"
     atgcacgaca atgacggtgt gacggtctgg gacaccctgg tcggacagga cgcggtggtc        60
     gccaccctga ccgccgcggc cacggcggcg gcgctggtca ccgagggtgg gtcgctggcc       120
     gccgcccggg cgggcatgac ccactcctgg ctgttcaccg gcccggccgg ctcgggcctc       180
     gccgacgcgg cccgggcctt cgccgccggc ctgctctgcg agaacatccc gccaggctgc       240
     gggcagtgcc cgggctgcca caccgtcctc tccgacaccg cggccgacct tcgcacggtc       300
     cgcccggagg gtctttcgat cggagtgcgg gacgtccgtg ccctgatcag ggacgccgcc       360
     agcgccccca gcgcgggccg atggcgcatc ctgctgattg aggacgcgga ccgcttcacc       420
     gactcggcgg cgaacgcgct actcaaggcg ctggaggagc cggccgagcg agccgtgttc       480
     ctgctgtgcg ccccatccgt cgacgacgtg ctgcccacca tccgctcccg gtgccggtcg       540
     gtcgccctgc ggctgccgaa cccgaagaac gtggccgacg tcctcatccg ggagggcaca       600
     gccgaggatc tcgccgccgt gctggcgcag gcgtcccagg ggcatgtcgg gcaggcccgc       660
     aggctggcca ccgacccgca ggcccgcgca cggcgggagt ctgtgctgcg cctgccctcc       720
     cggctgcggc gggtcggcga ctgcctggcc gcggccgccg acctggtgga cgccgcgaac       780
     gccgacgcgc aggccgcgaa cgccgagcgc gacgaggtcg agaccgaggc gctgaagacg       840
     gcgctgggcg tcggcgcgac gtcctccggt accaggtcga cgtccgcgcg gggtgccaag       900
     gcgggggcca agccgaggtc tctccaggtc cgcggcgctg ccggggcgct caaggagctg       960
     gagcggaccc agaagagccg cgggcggcgc actgttctcg actccctcga ccgggccctg      1020
     gtggatcttg ccgggctgta ccgggacgta ctggtccagc agctgcgggg gcaggtcacc      1080
     ccggtgcacc tcgaccaggc cgacgccgtc gcccagctgg ccgccgcggc caccccggag      1140
     cagacgttgc gccggtggga ggccgtcctg gcgacacggc aggcgctggc ggacaacccg      1200
     ggtcttgtgc cgcagctggc tgccgagtct cttgccctca cgctgcgcga cgcataa         1257
//

If you have problems or comments...

PBIL Back to PBIL home page