(data stored in ACNUC7421 zone)

EMBL: CP000820.PE306

CP000820.PE306       Location/Qualifiers
FT   CDS_pept        complement(366844..369915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0309"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: fal:FRAAL6579 DNA topoisomerase I
FT                   (omega-protein) (relaxing enzyme) (untwisting enzyme)
FT                   (swivelase); TIGRFAM: DNA topoisomerase I; PFAM: TOPRIM
FT                   domain protein; DNA topoisomerase type IA central domain
FT                   protein; SMART: DNA topoisomerase I ATP-binding; DNA
FT                   topoisomerase I DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09775"
FT                   /db_xref="GOA:A8LF30"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF30"
FT                   /protein_id="ABW09775.1"
FT                   /translation="MPPRTNSTSRTTAGSPTPVAEPTKPAAASATAASATAAKAEAAET
FT                   AEAGATAGRASGARATGGRRPARATTNGNGTRLVIVESPAKAKTIAGYLGPGWQVESSI
FT                   GHIRDLPRSAADVPTAHKGKPWARLGVDVDNGFEPLYVVSPDKKVQVSKLKSLVKDASE
FT                   LYLATDEDREGEAIAWHLLQTLKPTVPVKRMVFHEITPQAIQRAVDSPREINENLVNAQ
FT                   ETRRILDRLYGYEVSPVLWKKVMPKLSAGRVQSVATRILVERERARMRFRTAEYWNIEG
FT                   VFQQNVAHDGAALDTTPLPATLVALDGRRLASGRDFAPTGELTSDGVALLDEAGARALA
FT                   GRLTGAAFAVRSVETKPYRRSPYPPFMTSTLQQEAGRKLRFSSQRTMQVAQRLYENGYI
FT                   TYMRTDSTNLSETALVAARDQARTLYGAEYVPDRPRVYAKKVKNAQEAHEAIRPAGDHF
FT                   RTPGEVRSELDGDSFRLYELIWQRTVASQMADARGTSATIRLGATSSSGEDAEFSASGK
FT                   VITFPGFLRAYVEGADDPDAELEDRERRLPDVRRGDPLATRTLTPRGHTTSPPPRFTEA
FT                   SLVKTLEELGIGRPSTYASIIGTIQDRGYVWKKGSALVPSFVAFAVVGLLEDHFTRLVD
FT                   YQFTASMEDDLDAIAAGTAASTDWLTGFYFGLPDTTDTGGSGAVEGLKHLVGERLGEID
FT                   AREVNSIPLGKADDGEPVVVRVGRYGPYVQHADGRASVPDEVAPDELTVERALELLAAP
FT                   SGDRLLGTDPKTGASITAKAGRYGPYVTTDSEPPQTASLLRTMSLETVTLEDALRLLTL
FT                   PRVLGTDAEGAEVTAQNGRYGPYVKRGADSRSLESEDQLFTVTLDEALALLAQPKARGR
FT                   RQAAQTPPLRELGPDPATERPMVLREGRFGPYVTDGETNASLRKGDAVETITVERAAEL
FT                   LADRRARGTTTPRRTTKTTAKAPAKATAKPRTAAKTTTKAKTAGKTSGGTAKSGSRASK
FT                   SAASDAGATGTAAGDASGTDSATGATSGGSQRSS"
     gtgccaccgc gcacgaattc gacgagccgg acgaccgcgg ggtcgcccac gccggtcgcc        60
     gagcccacca agcccgcggc agcgagcgcc acggcggcca gcgccacggc agccaaggcc       120
     gaagcggccg agactgccga ggccggcgcc accgcagggc gcgcttcggg cgcccgcgcc       180
     acgggcgggc gccgcccggc gcgggccacc acgaacggta acgggacccg tctggtgatc       240
     gtggagtcgc cggccaaggc gaagacgatc gcgggctacc tgggcccggg gtggcaggtg       300
     gagtcgagca tcggccacat ccgcgacctg ccgcgcagcg ccgccgacgt gccgaccgcg       360
     cacaagggca agccgtgggc ccggctcggg gtcgacgtcg acaacggctt cgagcccctc       420
     tacgtcgtca gcccggataa gaaggtccag gtcagcaagc tcaagtcgct cgtcaaggac       480
     gccagcgagc tctacctggc gacagacgag gaccgcgagg gcgaggcgat cgcctggcac       540
     ctcctgcaga ctctgaagcc gaccgtcccg gtcaagcgga tggtcttcca cgagatcacc       600
     ccgcaggcca tccagcgtgc ggtcgacagc ccgcgggaga tcaacgagaa cctggtcaac       660
     gcccaggaga cccggcggat cctggaccgg ctctacggct acgaggtctc ccccgtgctg       720
     tggaagaagg tcatgcccaa gctctcggca gggcgggtcc agagcgtggc gacccgcatc       780
     ctcgtcgagc gggagcgggc gcggatgcgg ttccgcaccg cggagtactg gaacatcgag       840
     ggcgtcttcc agcagaacgt cgcgcacgac ggcgccgccc tcgacacgac cccgctcccg       900
     gcgaccctcg tcgcgctgga cgggcggcgc ctggccagcg gccgcgactt cgccccgacc       960
     ggcgagctga cgtccgacgg ggtcgcactg ctcgacgagg ccggtgcccg cgcgctggcc      1020
     gggcggctca ccggtgccgc gttcgcggtg cggtcggtcg agaccaagcc gtaccggcgc      1080
     tcgccctacc cgccgttcat gacctccacg ctccagcagg aggccggccg caaactgcgg      1140
     ttctccagcc agcgcacgat gcaggtcgcg cagcgcctct acgagaacgg ctacatcacc      1200
     tacatgcgga cggactcgac gaacctgtcc gagaccgccc tggtcgccgc ccgggaccag      1260
     gcccgcaccc tctacggcgc cgagtacgtc ccggaccggc cccgcgtcta cgccaagaag      1320
     gtcaagaacg cccaggaggc ccacgaggcg atccggcccg ccggggatca cttccggacc      1380
     ccgggtgagg tgcgctcgga gctcgacggt gactcgttcc gcctgtacga gctgatctgg      1440
     cagcgcacgg tggccagcca gatggccgac gcgcgcggca ccagcgccac catccgcctg      1500
     ggcgcgacct ccagctccgg ggaggacgca gagttctccg cctccggcaa ggtgatcacc      1560
     ttccccgggt tcctgcgcgc gtacgtcgag ggcgccgacg acccggacgc cgagctcgag      1620
     gaccgcgagc ggcggctgcc cgacgtccgg cggggggacc cgctggccac tcgcacgctc      1680
     accccgcgtg gccacacgac cagcccgccg ccgcggttca ccgaggccag cctggtcaag      1740
     acgctggagg agctggggat cggccggccg tccacctacg cgtcgatcat cggcacgatc      1800
     caggaccgcg gctacgtgtg gaagaagggg tccgcgctgg tcccgagctt cgtcgcgttc      1860
     gcggtggtcg ggctgttgga ggaccacttc acccggctcg tggactacca gttcacggcc      1920
     tcgatggagg acgacctcga cgcgatcgcc gctggtacgg ccgcgtccac ggactggctc      1980
     accgggttct acttcggtct gcccgacacg accgacaccg gcggttccgg cgcggtcgag      2040
     ggcctcaagc acctggtcgg cgagcggctc ggggagatcg acgcccgcga ggtcaactcc      2100
     atcccgctgg gcaaggcgga cgacggcgag cctgtcgtcg tgcgggtcgg ccgttacggg      2160
     ccctatgtcc agcacgccga cgggcgtgcc agcgtcccgg acgaggtcgc tcccgacgag      2220
     ctgaccgtgg agcgcgcgct cgaactgctg gccgcgccca gcggcgaccg tctgctcggc      2280
     acggacccga agacgggtgc gtcgatcacc gcgaaggccg gccgctacgg cccgtacgtg      2340
     acgacggaca gcgagccgcc gcagaccgcg agcctgctgc gcaccatgtc gttggaaacc      2400
     gtgaccctcg aggacgcgct gcggctgctg acgctccccc gcgtcctcgg caccgacgcg      2460
     gaaggcgcgg aggtcaccgc ccagaacggg cggtacggcc cctatgtgaa gaggggcgcc      2520
     gacagccgtt cgctggagtc cgaggaccag ttgttcacgg tgacgctgga cgaggcgctc      2580
     gcgctgctcg cgcagccgaa ggcccgcggt cggcgccaag cggcgcagac gccgccgctg      2640
     cgtgagctcg ggcccgaccc cgccaccgag cgcccgatgg tcctgcgcga gggccggttc      2700
     ggcccgtacg tgaccgacgg cgagaccaac gccagcctgc gcaagggcga cgcggtcgag      2760
     accatcacgg tcgagcgtgc cgccgagctc ctcgcggacc gccgagcccg cggcacgacc      2820
     acgccgcgcc ggaccacgaa gaccacggcc aaggcgcccg cgaaggccac agccaagccc      2880
     cggacggccg cgaagaccac cacgaaggcc aagaccgcgg gcaagacgtc gggcggcacg      2940
     gcgaagtccg gctcccgcgc gtcgaagtcc gccgccagcg acgccggggc gaccggcacc      3000
     gccgcgggcg acgcgtccgg caccgacagc gccaccggag caacgtccgg tggctcgcag      3060
     cggtcgagct ga                                                          3072
//

If you have problems or comments...

PBIL Back to PBIL home page