(data stored in ACNUC7421 zone)

EMBL: CP000820.PE308

CP000820.PE308       Location/Qualifiers
FT   CDS_pept        complement(373694..374212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0311"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: fal:FRAAL6575 putative anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09777"
FT                   /db_xref="GOA:A8LF32"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF32"
FT                   /protein_id="ABW09777.1"
FT                   /translation="MPTVELHFAALPGHVRTARMIATAVSRRAGVPAGAVDEIKLAVGE
FT                   ACARAVRVNRRSNPEALVHVALTDAPETFTVIVSDSGAPGDEVAPGPDGGLISAPALLD
FT                   LGGADLGGAAALGSAALTAPGLDGDPDADQPFPPGLGLALIEGLVDEVAVRRGTGRHGH
FT                   RRRDDLAHR"
     atgcccaccg tcgagttgca cttcgccgcc ttgcccggcc atgtccgtac cgcccggatg        60
     atcgcgaccg cggtcagcag gcgcgcgggc gtgccagccg gcgccgtcga cgagatcaag       120
     ttggcggttg gtgaggcgtg cgcccgagcc gtccgggtca accgccgtag caatcccgag       180
     gcgctggtgc acgtggcgct gaccgacgcg ccggagacgt tcaccgtcat cgtgtcggac       240
     agcggcgccc cgggagacga ggtcgccccc gggccggacg gcggcctcat cagcgcgcct       300
     gccctgctgg acctcggtgg cgcggacctc ggtggcgcgg cggccctcgg ctccgccgcg       360
     ctcaccgcgc cgggccttga tggcgaccct gacgccgacc agcccttccc gcccggcctg       420
     ggcctggccc tcatcgaggg cctggtcgac gaggtcgccg tccggcgcgg caccggacgg       480
     cacgggcacc gtcgtcgaga tgacctggca caccggtga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page