(data stored in ACNUC7421 zone)

EMBL: CP000820.PE31

CP000820.PE31        Location/Qualifiers
FT   CDS_pept        complement(40475..41677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0032"
FT                   /product="Protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase; KEGG: fal:FRAAL2702 putative
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09500"
FT                   /db_xref="GOA:A8LB39"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR027573"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB39"
FT                   /protein_id="ABW09500.1"
FT                   /translation="MTSCTADVSLAPLRNAMVERILAAKPVSAPVEAAMRTVPRELFLP
FT                   NLPPEVAYQDRAVVLKRDVYGNPVGSVSQPSVIAAMLEALRVEPGQRILELGSGGYGAA
FT                   LLARLAGRTCSVVSIDLDETVIHRTHEYLRAAGYTGITALVGDGRYGFRLRAPYDRIIV
FT                   TFDTLDVPQDWFDQLVEGGRVIIPLHLRGLTRTIAFTKTGGILTSDSIRPFAFGPMQGF
FT                   GVPRRTTVSLAGGARLDVGPDQDVDVDALCAALAEPRHTVGTGVILPPGNTLLPSLDLW
FT                   LATAQQTYGRLHTDTRTDQQGPDASAIPPGVPAVWSDDTIAFLALAQTTGTGLELGVIA
FT                   YGPQAGRLGDQLAHDVRAWNTEHYGKLPTIKVYPRGIVEKSPPPGRLLDLPSAQVLISW
FT                   G"
     gtgacgtcct gcacggccga cgtctccctc gcgccgctgc ggaacgcgat ggtcgaacgg        60
     atcctggccg ccaagccggt gtcggccccg gtcgaggctg cgatgcgcac ggttccacgc       120
     gagctgttcc ttccaaacct gccacccgag gtggcgtacc aggaccgggc cgtggtcctc       180
     aaacgcgacg tctacgggaa ccctgtgggc tcggtgtccc agccctcggt gattgcggcg       240
     atgctggaag cgctgcgggt cgaacctggc cagcggattc tcgagctggg ttccgggggc       300
     tacggggccg cgttgttggc gaggctggcc ggtcggacat gttcggtggt gagcatcgac       360
     ctcgatgaga ccgtgatcca ccgcacccac gaatacctgc gcgcggccgg ctacaccggg       420
     atcacggcgc tggtcggcga tgggcgttac gggttccggc tccgcgcccc ctacgaccgg       480
     atcatcgtca cgttcgacac gctcgacgtg ccacaggact ggttcgacca gcttgtcgag       540
     ggcggcaggg tcatcatccc gctacacctg cgcggtctca cccgcaccat cgcgttcacc       600
     aagaccggcg ggatcctgac ctccgactcg atccgaccgt tcgcgttcgg accgatgcaa       660
     ggattcggtg tcccccgccg aaccaccgtg tccctcgcag gcggggcacg gctcgatgtc       720
     ggccccgacc aggacgtcga cgtcgacgcc ctgtgcgccg ccctcgccga gccacggcac       780
     acggtgggaa ccggtgtcat cctccccccc ggaaacaccc tgctaccgag cctggacctg       840
     tggctggcca cagcccaaca gacctacggc cggctccaca ccgacacccg caccgatcag       900
     cagggcccgg acgcctcggc catcccgccc ggtgtgccag cagtctggtc cgacgacacg       960
     atcgccttcc tcgccctcgc acagaccacc ggcacgggac tcgaactcgg tgtgatcgcc      1020
     tacgggccgc aggcaggccg gctcggagac cagctcgctc acgacgtccg tgcctggaac      1080
     acagagcact acggcaagct ccccacgatc aaggtctacc cccgcggaat cgtcgagaag      1140
     tccccgccac cgggccggct tctcgacctg ccttccgcgc aggtactgat cagctggggc      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page