(data stored in ACNUC7421 zone)

EMBL: CP000820.PE310

CP000820.PE310       Location/Qualifiers
FT   CDS_pept        374926..377373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0313"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; Helicase superfamily 1 and 2
FT                   ATP-binding; SMART: DEAD-like helicases; KEGG:
FT                   fal:FRAAL6573 putative ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09779"
FT                   /db_xref="GOA:A8LF34"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF34"
FT                   /protein_id="ABW09779.1"
FT                   /translation="MGSPAVTEHDPARVGTVLGRLARDSRRAANITHVESVPARRGQPA
FT                   AWPEWADPLLVSRLRAAGIEQPWTHQVEAARAAHEGRGVVLATGTASGKSVGYLLPVLT
FT                   RLLAEPSSRAIYLAPTKALANDQLRSVRSLMLTGVRASTYDGDTPGPEREWVRAHATLV
FT                   LTNPDMLHRGILPAHRRWAPFLRGLRFVIVDECHGYRGVFGAHVAQILRRLRRVCARYG
FT                   TRPVFVLASATVADPGLSASRLTGVDVDVVDADASPRGPMDFALYEPPLLGVRAGRPST
FT                   PADGTEVGGPDVDGAGVDGAGAPVPHGENDAPVRRAATAESADLLADLVTEGVRTLVFV
FT                   RSRRAAEVVAAAARRGLGEAAPELVERVAAYRAGYLPEERRSLEGRLRTGELLGVAATS
FT                   ALELGVDISGLDATVIAGFPGTLASLWQQAGRAGRTGQAALAVLVARDDPLDTYLVHHP
FT                   EAVFGRPVEASVFDPDNPYVLMPHLECAASELPLTEDDLELFGPGARAAVDDLVRRGRL
FT                   RRRPTGWFWTQRHRPDVDIRGVGGPPVRIVETATGRLLGTVDAATSHSTVHAGAVYLHQ
FT                   GASFIVTELDLDDAVAFVEAATPDWATVAREHTDIRVVESTRSARFADVEIHLGTVEVT
FT                   NQVIAFQRRRLTTGEVLGQEPLDLPPRQLRTRAVWYTVTDELLAAAQIEPAEVPGAVHA
FT                   AEHAAIGLLPLFATCDRWDIGGVSTDLHPDTGRTSVFVYDGHAGGAGFAERGFLRVANW
FT                   LRATRDAVAACECPAGCPSCVQSPKCGNGNEPLEKAAAVRLLDAVLAAVDGDPADPSSP
FT                   RRE"
     gtgggttcgc cggccgtcac cgagcacgat cccgcgcgag tcggaaccgt cctgggccgg        60
     ctcgcccggg acagtcgacg ggcggccaac atcacccacg tcgagagcgt tcccgcccgg       120
     cggggccagc cggccgcgtg gccggagtgg gccgacccgc tgctcgtgag ccggctgcgt       180
     gcggcgggga tcgagcagcc gtggacccac caggtcgagg cggcccgggc ggcgcacgag       240
     gggcgcggcg tcgtgctggc caccggtacc gcttcgggga agtctgtggg ctacctgctg       300
     cccgtgctga cccggctgct ggcggagccg agctcgcgcg ccatctacct ggcgcccacc       360
     aaggcgctgg ccaacgacca gcttcgttcg gtgcgctcac tgatgctgac cggtgtccgg       420
     gcgtccacct atgacggcga caccccgggc cccgagcggg agtgggtgcg cgcgcatgcc       480
     acgctcgtcc tcaccaaccc ggacatgctg catcgtggga tcctgccggc acaccggcgc       540
     tgggccccgt tcctgcgcgg cctccggttc gtcatcgtcg acgagtgcca cggctaccgg       600
     ggcgtgttcg gcgcgcacgt cgcccagatc ctgcggcgcc tgcggcgggt ctgcgcccgg       660
     tacggcaccc ggccggtgtt cgtgctcgcc tcggcgacgg tggctgatcc gggcctgtcc       720
     gcctcccggc tgaccggcgt ggacgtcgac gtggtcgacg ccgacgcgtc tccccgaggg       780
     cccatggact tcgcgctgta cgagccgccg ctgctcggcg tccgcgcggg acggccgagc       840
     acccccgcgg acggcacaga agtgggtggc ccggacgtgg atggtgcggg agtggatggt       900
     gcgggcgctc ccgtgccaca cggagagaac gacgcccccg tccggcgggc cgcgaccgcc       960
     gagtccgctg atctgctcgc cgatcttgtc accgagggtg tgcggacgct ggtgttcgtc      1020
     cgttcccgcc gggccgctga ggtggtggcc gccgccgccc gccgcggtct gggcgaggcc      1080
     gcccccgaac tggtcgagcg ggtcgccgcc taccgggcgg gatacctgcc tgaggaacgc      1140
     cgttcgctgg agggacgcct ccggacgggt gagctcctcg gcgtggccgc cacgtccgcg      1200
     ctcgagctcg gcgttgacat cagcggactc gacgccacgg tgatcgctgg ctttcccggg      1260
     accctggcat cgctgtggca gcaggccggc cgcgcgggcc ggacggggca ggcggcgctc      1320
     gcggtcctgg tcgcgcggga cgatccgctg gacacctacc tcgtccacca tccggaggcc      1380
     gtcttcggcc ggccggtcga ggccagcgtg ttcgaccccg acaacccgta cgtgctcatg      1440
     ccccacctgg aatgcgccgc cagcgaactg ccgctgaccg aggacgacct ggagctgttc      1500
     gggccaggtg cccgcgcggc ggtcgacgac ctcgtccggc gcgggcggct gcgtcgacga      1560
     cccaccggct ggttctggac ccagcggcac cgcccggacg tcgacatccg tggtgtcggc      1620
     ggcccaccgg tgcggatcgt cgagacggcg acgggccggc tgctcggcac cgtcgacgcg      1680
     gcgacctcgc actcgacagt gcacgcgggg gcggtgtacc tgcatcaggg cgccagcttc      1740
     atcgtcaccg agctcgacct ggacgacgcg gtggccttcg tcgaggcggc gacgccggac      1800
     tgggccacgg tcgcgcggga gcacaccgac atccgggtcg tcgagtccac ccgctccgcg      1860
     cggttcgccg acgtcgagat ccatctcggg acggtcgagg tcaccaatca ggtgatcgcc      1920
     ttccagcgac gccggctgac aaccggggag gtcctcgggc aggagccgct cgacctgccg      1980
     ccgcgccagc tgcgcacgcg ggctgtctgg tacacggtga ccgacgagct cctcgccgcg      2040
     gcccagatcg aacccgccga ggtgccgggg gcggtgcacg ccgccgagca cgcggcgatc      2100
     ggcctgctgc ccctgttcgc gacatgcgac cggtgggaca tcggcggggt ctccaccgac      2160
     ctgcacccgg acaccggccg caccagtgtc ttcgtctacg acggccatgc cggtggcgcg      2220
     gggttcgccg aacgcggttt cctgcgggtg gcgaactggc tgcgggcgac ccgggacgcc      2280
     gtcgccgcgt gcgaatgccc ggccggctgc ccgtcctgtg tccagtcgcc gaagtgcggc      2340
     aacggcaacg agccgctcga gaaggcggcc gccgtccggc tgctcgacgc cgtgctggca      2400
     gcggtggacg gcgaccccgc ggacccgtcg agcccccggc gggaatga                   2448
//

If you have problems or comments...

PBIL Back to PBIL home page