(data stored in ACNUC7421 zone)

EMBL: CP000820.PE311

CP000820.PE311       Location/Qualifiers
FT   CDS_pept        377482..378504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6572 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09780"
FT                   /db_xref="GOA:A8LF35"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF35"
FT                   /protein_id="ABW09780.1"
FT                   /translation="MVTVGVVLLLLAGVLTADIVLENSGQTEVMIMGQSLSFDVWGLFV
FT                   LGLATGVLVVAGTQITLQGFARDRHRRRLERQRARDLAAMTRAVPTPAPRHSAPTAPTT
FT                   ASAPTAGSAATTGPTPVGAAPRSGPAPVPAGGPGAVIPGGAAGTAPSRRSAVPTPAMPA
FT                   QTGSVPTTAPDPVVRAQPSRQAAAAAADTGPLRMGRRGTGEGQPGEGRAAGAPTQQGAA
FT                   VTVPVGQAGGGRANATAPTPVAAPESAPGSGRPAGRRPARAERAATTGSPAAPARPVPT
FT                   AHPGDRVVARVSDLRRKKREAQAAETAPGAPTAPGPVSGASGAAPASGSPTPPAGVRTP
FT                   "
     gtggtcaccg tcggtgtggt cctgttgctt ctggcgggtg ttctcaccgc ggacatcgtc        60
     ctggagaact ccggtcagac agaagtaatg atcatgggtc agtcgctctc cttcgacgtc       120
     tgggggctgt tcgttctcgg gctcgcgacc ggcgtgttgg tggtggccgg tacgcagatc       180
     acgttgcagg gcttcgcccg ggacaggcac cggcgccggc tggagcgcca gcgtgcccgc       240
     gacctggccg ccatgacgcg ggccgtgccc accccagcgc cccggcactc ggccccgacc       300
     gccccgacta ccgcctccgc cccgacagct gggtccgccg cgaccactgg gcccactccg       360
     gtgggggcgg cgcctcgttc cggcccggcc ccggttcccg ccggtggccc cggcgccgtc       420
     ataccgggtg gggccgctgg aaccgcgccc tcgcgccgat ccgcggtccc gacaccggct       480
     atgcccgcac agaccggctc cgtgccgacg accgcgcctg acccggtcgt gcgtgcccag       540
     cccagtcgcc aggcggctgc cgcggcagcc gacaccggtc cgcttcggat ggggcgccgt       600
     gggaccgggg agggccagcc cggcgagggg cgggccgctg gcgcaccgac ccaacagggt       660
     gccgccgtga ccgttccggt cggccaggcc gggggcgggc gagcgaacgc aaccgccccc       720
     acgcctgtgg ccgcgccgga atccgcgccg gggtcgggac ggccggcggg acgtcggccc       780
     gcccgcgccg agcgcgccgc cacgaccggc tcgccggccg ctccggcgcg gcccgtgccg       840
     acggcgcatc cgggggaccg cgtcgtggcc cgggtttccg acctgcggcg caagaagcgc       900
     gaggcgcagg cggccgagac cgcccctggt gcccccacgg cgccggggcc cgtctccggg       960
     gcgtccgggg cggcgccggc gtccgggtcg cccacacctc ccgcgggcgt gcgcaccccc      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page