(data stored in ACNUC7421 zone)

EMBL: CP000820.PE313

CP000820.PE313       Location/Qualifiers
FT   CDS_pept        complement(379368..379640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0316"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6568 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09782"
FT                   /db_xref="GOA:A8LF37"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF37"
FT                   /protein_id="ABW09782.1"
FT                   /translation="MSPEATMLFLYALLRPRRSVPSPRPRHRRWYRSPRSNAGVPTDAG
FT                   MSTAEYAVGTLAAVAFAGVLYAVISSSATRSLISSVVQRALTVAF"
     ttgagcccgg aggcaaccat gctgttcctg tacgcgctgc tccgcccgcg gcgctccgtg        60
     ccctcgccgc ggccacggca ccggcgctgg taccgctcgc cccggtcgaa cgcgggcgtg       120
     ccgacggacg cgggaatgtc gacggccgaa tacgcggtcg gaacgctggc cgccgtcgct       180
     ttcgcggggg tcctctacgc ggtcatctcg agctcggcca cccgctcatt gatctcctcg       240
     gtcgtacagc gcgcgctgac agtcgcgttc tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page