(data stored in ACNUC7421 zone)

EMBL: CP000820.PE317

CP000820.PE317       Location/Qualifiers
FT   CDS_pept        complement(384542..385531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09786"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF41"
FT                   /protein_id="ABW09786.1"
FT                   /translation="MTARSSVSVVGTDPLSQVAAIPGVDEAATAARAAVDALLRHRILR
FT                   RRSAEVTAEASLRAARASAALEGHDIALDALRARLGETGRDNDQPAVSVSQSADPWERS
FT                   LAVTLGAVRLYAELGTLSSAWERAPRQALARMHVLAGRGLLPDDVLGRPRTDVSWSPTS
FT                   ITGAAVTDVAGSPPVPAMPAAEMSQRLDGLTAVLTVPTRAPAIVVAAITHGELLAIHPF
FT                   GALDGIIARAAARLVLVSRGLDPKALVATDVGHLELDRDRTGPAGAAGTGAVVPGVGVG
FT                   TEPDYRAALAAYVAGGAEGVGVWVRHCAGALELAARESLAVCEALSRG"
     gtgacagcac gttcgtcggt atcagtcgtc ggaaccgacc cactgagcca ggttgcggcg        60
     attcccggtg tcgacgaggc cgcgacggca gcccgcgcgg ccgtcgacgc gctccttcgg       120
     catcgcatcc tgcggcgccg cagtgccgag gtgaccgccg aggcatcgct gcgggcggcc       180
     cgcgcctcgg ccgcgctgga gggccacgac atcgcgctgg acgcgctgcg ggcccggctg       240
     ggcgagaccg gccgcgacaa cgaccagccc gcggtctcgg tcagccagtc ggccgacccg       300
     tgggaacgct cactcgccgt gacgctggga gcggtacgcc tctacgcgga gctgggcacg       360
     ctctcctccg cctgggagcg cgcgccgcgc caggcgctgg cacgcatgca cgtcctcgcc       420
     gggcgcgggc tgcttcccga cgacgtgctc ggccggccgc gaacggacgt ctcatggtcg       480
     ccgaccagca tcaccggggc cgccgtcacg gacgtcgcgg gatctccgcc cgtgccggcg       540
     atgccggcgg cggagatgtc ccagcgcctg gacgggctca ccgcggtgct gaccgtgccg       600
     accagggctc ccgcgatcgt ggtcgcggcg atcacgcacg gtgagctgct cgcgatccat       660
     cccttcggcg cgctcgacgg gatcatcgcc cgggccgccg cgcgcctcgt cctggtcagc       720
     cgcggcctgg acccgaaggc actggtggca acggacgtcg gccatctcga gctcgaccgc       780
     gaccgcaccg gcccggcggg agcggccggc acgggtgccg tagtaccggg tgtgggtgtc       840
     ggcacggagc cggactaccg tgccgcgctc gccgcgtacg tcgcgggcgg cgccgagggt       900
     gtcggggtct gggtgcggca ctgtgccgga gccctggagc tggcggcgcg ggagtccctc       960
     gcggtgtgcg aggcactctc ccggggctga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page