(data stored in ACNUC7421 zone)

EMBL: CP000820.PE32

CP000820.PE32        Location/Qualifiers
FT   CDS_pept        complement(42120..42485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09501"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB40"
FT                   /protein_id="ABW09501.1"
FT                   /translation="MVGCAVRMTPRSPLVPVALRPVVLIARMAALPELTPPEDIARILA
FT                   TFTPPIDPASPEWAALRTALDRYDAAHDQAAFDAARRQIVLAAVTLLLGPPGYSAPDTP
FT                   ARCRVPAQRTPPPSRRT"
     atggtcggct gcgcagtccg catgaccccg cgttcccctc tcgttcccgt cgcgttgcgc        60
     ccggtcgtgc tgatcgcgcg tatggccgcc ctgcccgagc tcacaccacc ggaggacatc       120
     gcacggatac tcgccacgtt caccccaccc atcgacccgg cctcgccgga atgggccgcc       180
     ctgcgcaccg ccctcgaccg ctacgacgcc gcgcacgatc aggccgcctt cgacgcggcc       240
     cgcaggcaga tcgtccttgc cgccgtcacc ctcctgctcg gcccgccagg ctacagcgcg       300
     cctgacacgc ccgcccggtg tcgcgtaccc gcacagcgca caccgccccc gagccgccgc       360
     acgtga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page