(data stored in ACNUC7421 zone)

EMBL: CP000820.PE322

CP000820.PE322       Location/Qualifiers
FT   CDS_pept        complement(389115..389951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0325"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: fal:FRAAL6559
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09791"
FT                   /db_xref="GOA:A8LF46"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF46"
FT                   /protein_id="ABW09791.1"
FT                   /translation="MSDPAPSGDPSSQDAHSASADGDAPPASADGDTRPASGGGAPVPP
FT                   WLTALMAAVGDGIPVQTRHARQTRPGGRAAAVLILFGEGPDGPDVLLLQRAADMRDHAG
FT                   QPAFPGGGADETDASRAATALREAEEEVGLDPAGVEVLATASPLYLAASHFLVTPVLAW
FT                   WRTPTAVDAVDPAETSSVARVPVAELADPANRILLWHPSGFGSPAFRVRGMTVWGFTAG
FT                   VLDALLRLGGWERPWDTETKVDVPEITVAISAAMALPHAVVEPRGPLDEAGGTVGR"
     gtgagcgacc ccgcaccgtc cggggatccg agcagccagg acgcccactc cgcgagcgcc        60
     gacggagacg cccctccggc gagcgccgac ggagacactc gtccggcgag cggcggcgga       120
     gctccggttc ccccatggct gaccgcgctg atggcggcgg tgggcgacgg catccccgtc       180
     cagacgcgac acgctcgcca gacgcggccg ggcgggcggg cggcggccgt cctgatcctg       240
     ttcggggagg gtccggacgg gcctgacgtg ctgctcctgc agcgggccgc cgacatgcgc       300
     gaccatgccg ggcaaccggc gttccccggc ggcggcgccg acgagaccga cgcgtcgagg       360
     gccgcgacgg cgctgcgtga ggcggaggag gaggtcgggc tcgacccggc cggcgtcgag       420
     gtcctcgcca ccgccagccc cctctacctg gctgccagcc acttcctggt cacccccgtg       480
     ctcgcctggt ggcgcacgcc caccgcggtg gacgcggtcg acccggcgga gacgtcctcg       540
     gtggcccggg tacccgtcgc ggagctcgcc gacccggcga accggatcct gctgtggcat       600
     ccgtccggct tcggcagccc ggcgttccgc gtccgcggta tgacggtctg gggtttcacc       660
     gcgggcgtcc tcgacgccct gctgcggctc ggcggatggg aacgcccctg ggacaccgag       720
     acgaaagtgg acgtgcccga gatcaccgtg gcgatctccg cggccatggc cctcccccac       780
     gcggtggtgg agccgcgggg accactcgac gaagcgggcg gtaccgtcgg aagatga          837
//

If you have problems or comments...

PBIL Back to PBIL home page