(data stored in ACNUC7421 zone)

EMBL: CP000820.PE326

CP000820.PE326       Location/Qualifiers
FT   CDS_pept        complement(392138..395995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0329"
FT                   /product="adenylate/guanylate cyclase with TPR repeats"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   TPR repeat-containing protein; Tetratricopeptide TPR_4;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: fal:FRAAL6555
FT                   putative adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09795"
FT                   /db_xref="GOA:A8LF50"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF50"
FT                   /protein_id="ABW09795.1"
FT                   /translation="MVISSPTTGPLVCPRCGTPTVPGGRFCFNCGLRFTQTDTPRAEAA
FT                   ERRVVTVLFGDLSDFTAWAEDRDPERVGEVTDRVLAALAREVDEVGGRVDNLSGDGIMA
FT                   VFGAPTAHEDDPERAVRAAAAMQETARRLIKDEGGDSSPLGLRVGVNTGEVLAGVQAAL
FT                   SYTVIGDTVNTAARLSGAAAVGTVYAGRDTVTATRSVATWRDLPPLVLKGKREPVPAYE
FT                   LVSLRPSNIARPGLADDATFIGREQELAELSRYFAGVVDAGQPDMAVVIGEAGIGKTRL
FT                   ARELAETAEATAGATVLWGRTVRHGDVRDLAPLIDLIRGACGITDGDTLDRVADRVRRT
FT                   VAGLTHPIFETKLPSGIGDRLLGMLGVPPDRRPSAGATTPPGDPVGRASHGEAVQRAAD
FT                   DAVETVGLLLSALAVRNPVLVVVDDLEWATSRLTTALRRLTTTLSGPVMLVLLDRESPQ
FT                   FSDLVGARRIALSPLPESAARALLKDYLGEPGLSRATQAELLARVHGNPFFLTELLNLL
FT                   VDRGLLHQVPDPGGEGMRWVLEGSLAATVLPAGVQSVLAARIDDLDAAAKAALRAAAVL
FT                   GPRFPAEALQVVGERPAAEVERALSVLTERQLVRPPRQGETLWRFVHPMARDVAYSGLP
FT                   KVERARRHATAARWGVTAMIGSSREVSTFVATHALRAYDLAASMALPAGDPAWSAREAG
FT                   FHAHVRLARSALARDDHRAAADLLADARRLGRGVIDGDDDINVRILHAEALVWLRRLDE
FT                   AERTLRPALRVNVPSRRAAAYAVLGELRQKQGRGEEARQSLITALEAAHRAGDDRAVAA
FT                   ALRRLGLLEYAAGRIQAAEERYREALSLARRVDDPRGVGWALQHLAWSATTRGDYAKAE
FT                   RTLREASAVFERLEDAGGLGWCSGTEALVLLLSGQLTRTRKVSRVLINLAESMRERWGQ
FT                   AVCLTIDAVAAAELGDIETAESEAARAAELFTETGDSWGRTLTLIARGLAARGAGRPRR
FT                   GADLLTEACAEAASTGHVLIGAFAQVLLGLTRLDAGEVDAAEEAARRALADLDRLELRP
FT                   HAQLGAKVLVAQIARARGRLDEAITELRGALSASEPATLMFPRRQAYAHLAGTLLDAGE
FT                   PDEALRVARQAVGVDAEDVRAQVLAYRALGTVLAAHGDVEGSREAYEQALAAATATGAI
FT                   SEAPQTRRLLAALPGSAPDALDAPDGLDAADGLGAADGLGVADGLGTPHQDGLAAQDDL
FT                   SAQDGLGAAAALAKVSVNGTRARARTAARLPGSPVVVPVADPSGEAVPSVEMPPAEGTS
FT                   R"
     atggtgatca gctcccccac gaccggtccc ctggtctgcc ccagatgcgg caccccgacg        60
     gtgcccggcg ggcggttctg cttcaactgc gggctccggt tcacccagac cgacacgccg       120
     cgcgccgagg ccgccgagcg ccgggtcgtc accgtcctgt tcggtgacct gtccgacttc       180
     accgcctggg cggaggaccg cgaccccgaa cgggtcggcg aggtcaccga ccgggtcctc       240
     gccgcgctcg cgcgcgaggt cgacgaggtc ggcgggcggg tcgacaacct cagcggtgac       300
     ggaatcatgg ccgtcttcgg cgccccgacg gcgcacgagg acgacccaga acgcgccgtg       360
     cgcgccgcgg cggcgatgca ggagacggcc cgtcgcctga tcaaggacga gggcggcgac       420
     agcagcccgc tcggcctgcg ggtcggcgtc aacaccggcg aggtgctcgc cggtgtgcag       480
     gcggcgctgt cgtacacggt catcggggac acggtgaaca ccgccgcgcg gttgtccggc       540
     gcggccgcgg tgggcaccgt ctacgccggc cgggacacgg tcaccgccac ccgctccgtc       600
     gccacctggc gcgatctgcc gcccctggtg ctcaagggca agcgcgagcc ggtgcccgcc       660
     tacgagctgg tcagcctgcg tccgtccaac atcgcccggc ccggcctggc cgacgacgcg       720
     acgttcatcg ggcgcgagca ggagctggcc gagctcagcc gctacttcgc cggcgtggtc       780
     gacgccggcc agcccgacat ggcggtggtc atcggcgagg ccggcatcgg caagacccgg       840
     ctggcccggg agctcgccga gaccgccgag gcgaccgcgg gcgcgaccgt gctgtggggg       900
     cgcaccgtgc gccacggcga cgtccgcgac ctcgccccgc tgatcgacct catccgcggg       960
     gcgtgcggca tcaccgacgg cgacaccctc gaccgggtcg ccgaccgggt acgccgcacg      1020
     gtcgccggcc tcacccatcc gatcttcgaa acgaagctgc cgagcggcat cggagaccgc      1080
     ctgctcggga tgctcggcgt gccgccggac cgccgtccca gcgccggggc gaccaccccg      1140
     ccgggtgacc cggtcggccg ggcctcccac ggcgaggcgg tccagcgggc cgccgacgac      1200
     gccgtcgaga cggtcggcct cctgctgagc gcgctggcgg tccgcaaccc ggtgctggtc      1260
     gtcgtcgacg atctggagtg ggcgaccagc cggctgacga cggccctgcg gcggctgacg      1320
     acgaccctca gcggcccggt gatgctcgtc ctgctcgacc gggagagccc gcagttctcc      1380
     gatctcgtcg gcgcgcgccg catcgcgctc agtccgctgc cggagagcgc ggcgcgtgcc      1440
     ctgctcaagg actacctggg cgagcccggc ctgtcccggg cgacccaggc cgagctgctg      1500
     gcccgggtgc acgggaaccc gttcttcctg accgagctgc tcaacctgct ggtggaccgc      1560
     ggtctgctgc accaggtgcc cgaccctggc ggcgagggga tgcgctgggt gctggaggga      1620
     tcgctggccg cgaccgtcct gcccgccggt gtccagtcgg tgctggcagc caggatcgac      1680
     gacctggacg cggccgccaa ggcggcgctg cgcgcggcgg ccgtgctcgg cccgcgcttc      1740
     cccgccgagg cgctccaggt ggtcggcgag cgcccggcgg ccgaggtcga acgcgcgctg      1800
     tcggtgctca ccgagcgcca gctcgtccgc ccaccgcggc agggcgagac cctgtggcgg      1860
     ttcgtccacc cgatggcgcg cgacgtcgcc tactcgggcc taccgaaggt ggagcgggcc      1920
     cgccggcacg ccacggcggc gcgctggggc gtcacggcaa tgatcggttc gtcccgcgag      1980
     gtgtcgacct tcgtcgccac ccacgcactg cgcgcctacg acctggccgc ctcgatggcg      2040
     ctgcccgcgg gcgacccggc ctggtcggcg cgggaggccg gcttccacgc gcacgtccgg      2100
     ctggcccgct cggcgctcgc ccgcgacgac caccgggccg ccgcggacct gctcgccgac      2160
     gcccgccggc tcgggcgggg cgtcatcgac ggcgacgacg acatcaacgt gcggatcctg      2220
     cacgccgagg cgctggtctg gctgcgccgg ctcgacgagg cggagcggac gctgcgcccg      2280
     gcgctgcggg tgaacgtccc gagccggcgg gccgccgcct acgcggtgct cggtgagcta      2340
     cggcagaagc agggccgtgg cgaggaggcc cgccagtcgc tgatcacggc gctggaggct      2400
     gcgcaccggg ccggcgacga ccgggcggtg gccgcggcgc tgcgccggct cggcctgctc      2460
     gaatacgccg ccggccgcat ccaggccgcg gaggagcgct accgcgaagc actctcgctc      2520
     gcccgccgcg tcgacgaccc ccgcggggtc ggctgggcgc tgcagcacct ggcgtggagc      2580
     gccaccaccc gcggggacta cgcgaaggcc gagcgcacgc tgcgcgaggc gtccgcggtg      2640
     ttcgagcggc tggaggacgc cggcgggctc ggctggtgct cgggcaccga ggccctcgtc      2700
     ctgctgctct cgggtcagct cacccggacc cgcaaggtct cccgcgtgct catcaacctc      2760
     gccgagtcga tgcgcgagcg ctgggggcag gcggtctgcc tgacgatcga cgcggtcgcc      2820
     gcggccgagc tcggcgacat cgagaccgcc gagagcgagg cggcccgcgc ggcggagctg      2880
     ttcaccgaga ccggcgacag ttgggggcgc acccttaccc tcatcgcgcg cgggctggcc      2940
     gcccgtgggg ctggccgccc ccggcgcggt gcggacctgc tgaccgaggc gtgcgcggag      3000
     gcggcgtcca ccgggcatgt gctcatcggc gccttcgccc aggtgctgct cggcctgacc      3060
     aggctggacg ccggcgaggt ggatgccgcg gaggaggccg cccggcgcgc cctggccgac      3120
     ctggaccggc tggaactgcg cccgcacgcc cagctcgggg cgaaggtgct cgtcgcgcag      3180
     atcgcgcggg cgcgcggccg cctcgacgag gcgatcaccg agctgcgggg ggccctgtcc      3240
     gccagcgagc cggcgacgct gatgttcccg cgccggcagg cctacgccca cctcgcaggc      3300
     accctgctcg acgcgggcga gcccgacgag gccctgcggg tggcacgcca ggcggtcgga      3360
     gtggacgccg aggacgtccg ggcacaggta ctggcatacc gggcgctggg gacggtcctg      3420
     gcggcgcacg gtgacgtcga gggcagccgc gaggcctacg agcaggccct ggccgccgcg      3480
     acggccaccg gcgcgatcag cgaggcgccg cagacccggc ggctgctcgc ggccctgccg      3540
     ggatccgccc cggacgccct cgacgcaccg gacgggctcg acgcagcaga cggactcggc      3600
     gcagcagacg gactgggcgt ggcggacggg ctgggcacac cgcaccagga cgggctggcc      3660
     gcccaggatg acctgagcgc acaggacggg ctgggcgcgg cggccgcgct ggcgaaggtg      3720
     agcgtgaacg ggacgagggc gcgggccagg acggcggcgc gtctgccggg atcaccggtg      3780
     gtcgtgccgg tggccgaccc gtccggtgag gccgtgccct cggtggagat gccgcccgcc      3840
     gagggcacca gccggtag                                                    3858
//

If you have problems or comments...

PBIL Back to PBIL home page