(data stored in ACNUC7421 zone)

EMBL: CP000820.PE327

CP000820.PE327       Location/Qualifiers
FT   CDS_pept        complement(396470..397249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0330"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   fal:FRAAL6554 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09796"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF51"
FT                   /protein_id="ABW09796.1"
FT                   /translation="MTALRRVTKLASVVLAPNPGPMTLDGTNTWILRSPGDAGCVVVDP
FT                   GPDHGEHLARVAAAGLVRTILLTHGHSDHSEGAATLHALTGAQVRALDPAHRLGSEGLG
FT                   AGDVVAAAGVELRVLATPGHTSDSLSFVLAGDDEHPAVLTGDTILGRGSTVVAHPDGRL
FT                   ADYLSSLRLLRELGDTTVLPGHGPELPAAGRAAEAYLEHRARRLDQVISALADLGASAE
FT                   QVTPIDVVRIVYADVDVALWPAAELSVRAQLDYLRPR"
     gtgaccgccc tccgccgggt cacgaagctg gcctccgtcg tcctcgcgcc gaatcccggc        60
     ccgatgaccc tcgacggcac gaacacctgg atcctgcggt caccgggcga cgccggctgc       120
     gtggtggtcg atcccggccc cgaccacggc gagcacctcg cccgggtcgc ggccgccggc       180
     ctggtgcgca cgatcctgct gacccacggc cactccgacc acagcgaggg cgccgcgacg       240
     ctgcacgcgc tgaccggggc gcaggtgcgc gccctcgacc cagcgcaccg cctcggctcg       300
     gagggcctcg gcgccgggga cgtcgtcgcc gccgccgggg tcgagctgcg ggtgctggcc       360
     acccccgggc acacctcgga ctcactgtcc ttcgtgctgg ccggcgacga cgagcacccg       420
     gccgtgctca ccggcgacac gatcctgggg cgcggcagca cggtcgtcgc ccatcccgac       480
     ggccggctcg ccgactacct ctcgagcctg cgcctgctgc gcgagctcgg cgacaccacc       540
     gtgctgcccg gccacggccc cgagctgcca gcggccgggc gggcggccga ggcctatctg       600
     gagcaccggg cccggcggct cgatcaggtg atctccgcgt tagccgatct gggtgcgtcg       660
     gccgagcagg tgacgccgat cgacgtggtc cggatcgtgt acgcggacgt cgacgtggca       720
     ctctggccgg cggccgagct gtcggtacgg gcccagttgg actacctccg cccacgctga       780
//

If you have problems or comments...

PBIL Back to PBIL home page