(data stored in ACNUC7421 zone)

EMBL: CP000820.PE330

CP000820.PE330       Location/Qualifiers
FT   CDS_pept        complement(398969..399130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09799"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF54"
FT                   /protein_id="ABW09799.1"
FT                   /translation="MQTKWEYMTAPLLIHATKQILDNFGADGWELVQVVPGPNPESLVA
FT                   YFKRPKSQ"
     atgcagacca agtgggagta catgactgcc ccgctcctga tccacgccac caagcagatc        60
     ctcgacaact tcggtgccga cggctgggag ctcgtccagg tcgtccccgg gcccaacccg       120
     gagagcctgg tggcgtactt caagcggccg aagtcccagt ag                          162
//

If you have problems or comments...

PBIL Back to PBIL home page