(data stored in ACNUC7421 zone)

EMBL: CP000820.PE337

CP000820.PE337       Location/Qualifiers
FT   CDS_pept        408054..408719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0340"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: fal:FRAAL0823 putative two-component system
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09806"
FT                   /db_xref="GOA:A8LF61"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF61"
FT                   /protein_id="ABW09806.1"
FT                   /translation="MRVTPTRVVLADDAPLFRQAIAWLLEQHDFQVVGQVSDADGLRNA
FT                   VSALRPDIAVIDIRMPPTGRLEGLESAVELRARHPDLGVLLLSHYLESHYLPVLFGANA
FT                   RGVGYLLKERVTGIEAFVEAVTRVAAGGCVLDPEVVDLMIAARSRRDPLHTLTAREREV
FT                   LALMAEGRSNQAIGAQLVLTPKTVESHVRSIFTRLGLAPEPDDHRRVLAVLTYLRAHH"
     atgcgtgtga cgccgacccg ggtcgtcctg gcggacgacg cgccgctgtt ccgtcaggcc        60
     atagcctggc tgctggagca gcacgacttc caggtcgtgg ggcaggtgag cgacgccgac       120
     gggctgcgta acgcggtctc ggcgctacgc cccgacatcg cggtcatcga catccgcatg       180
     cctcccaccg gccggctgga aggcctggag agcgcggtgg agctgcgcgc ccggcatccg       240
     gacctcgggg tgctgctgct ctcgcactac ctggagtcgc attaccttcc ggtgcttttc       300
     ggcgcgaacg cccggggcgt gggctatcta ctcaaagagc gcgtgaccgg catcgaggcg       360
     ttcgtcgagg ccgttacccg ggtcgcggcg ggaggctgcg ttctcgaccc cgaggtcgtc       420
     gacctgatga tcgccgcccg gtcgcggcgt gatcccctgc acaccctgac cgcccgcgaa       480
     cgggaggtgc tcgcgctgat ggccgagggc cgttccaacc aggcgatcgg tgcgcagctg       540
     gtcctcactc cgaagacggt cgaatcccat gtgcgcagca ttttcacccg gctcggcctg       600
     gcacccgaac cggacgatca ccggcgggtt ctcgcggtgc tcacctatct gcgagcacat       660
     cactga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page