(data stored in ACNUC7421 zone)

EMBL: CP000820.PE344

CP000820.PE344       Location/Qualifiers
FT   CDS_pept        complement(416191..416526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09813"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF68"
FT                   /protein_id="ABW09813.1"
FT                   /translation="MEIHGDPWISGPAGPGLLHCQTVDSEFGVSRITTRNTTWRSGRDR
FT                   DVSGSTGPPARPARPGTRRRKEVEMRTGSEAAGTTRGGRRSGVHLGTLTVTTSESSKMI
FT                   DINEERL"
     gtggagatcc atggagatcc atggatctcc ggtccggccg ggccgggtct actccactgt        60
     caaacggttg actccgaatt tggcgtaagt aggattacga cacgaaatac gacgtggcgg       120
     tcaggacgcg atcgagacgt gtcaggctcc accgggccgc ccgctcggcc cgcccgcccc       180
     ggcacgcgtc ggagaaaaga ggtcgagatg cgaaccggga gcgaagcggc gggcacaacc       240
     cgtggcgggc ggcgttccgg tgtgcacctc ggaactctca ccgtgacgac gagcgagtca       300
     tcaaagatga tcgacatcaa cgaggagcgg ctgtga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page