(data stored in ACNUC7421 zone)

EMBL: CP000820.PE345

CP000820.PE345       Location/Qualifiers
FT   CDS_pept        complement(416807..418222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0348"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein; KEGG: fal:FRAAL6537 prolyl-tRNA synthetase
FT                   (proline--tRNA ligase)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09814"
FT                   /db_xref="GOA:A8LF69"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF69"
FT                   /protein_id="ABW09814.1"
FT                   /translation="MDDVAVLTPRSTDFPRWYQDVLDKAELADNGPVRGTMVIRPYGYA
FT                   LWERMQADVDTRIKAAGAVNAYFPLFIPESYLRREAEHVEGFSPELAVVTHGGGKELAE
FT                   PVVVRPTSETVIGEYMAKWTQSYRDLPLLLNQWANVVRWELRPRLFLRTSEFLWQEGHT
FT                   AHADAADAAAYARRIALEVYREFMTSVLALPVFVGAKTRKERFAGAINTMTCEGMMGDG
FT                   KALQMATSHELGQNFARAFDIDFLGPDGGRHLAWTTSWGSSTRMIGGLIMAHGDDNGLR
FT                   VPPVLAPTQVVVLPVRDDDAVVTKAREITDALTALGVRARLDARPGLSFGRRVTDAELK
FT                   GIPVRVEVGPRDLAAGNVTLARRDTAEKFPVPLGEAAGRVPVLLDEVQASLYAQALALR
FT                   DERTSDVTSLTEAVEAAATGFARLPWRLVGEDGEARLAEDSLTVRCLQTPDGALPTADT
FT                   RDEDLVCLVARAY"
     gtggacgacg tggctgttct caccccccgc tccaccgact tcccgcgttg gtaccaggac        60
     gtgctcgaca aggccgagct cgccgacaac gggcccgtgc gcggcacaat ggtcatccgg       120
     ccgtacggct acgcgctgtg ggaacggatg caggccgacg tcgacacccg gatcaaggcc       180
     gcgggcgcgg tgaacgccta cttcccattg ttcatcccgg agagctacct gcgccgggag       240
     gccgagcatg tcgaggggtt cagccccgag ctggccgtcg tcacccacgg tggcggcaag       300
     gagctggccg aaccggtcgt cgtccgtccc accagcgaga cggtgatcgg cgagtacatg       360
     gccaagtgga cgcagagcta ccgggatctg ccgctgctgc tgaaccagtg ggcgaacgtc       420
     gtccgctggg agctgcgccc gcggctgttc ctgcgcacca gcgagttcct gtggcaggag       480
     gggcacaccg cccatgcgga cgccgcggac gccgccgcct atgcccgccg gatcgcgctc       540
     gaggtgtacc gggagttcat gacctcggtg ctcgcgctgc cggtgttcgt cggggcgaag       600
     acccgcaagg agcgcttcgc cggcgcgatc aacacgatga cctgcgaagg catgatgggt       660
     gacggcaagg cgctgcagat ggcgacgagc cacgagctcg gccagaactt cgcccgcgcc       720
     ttcgacatcg acttcctcgg gccggacggc ggccgccacc tggcgtggac gacctcctgg       780
     ggcagctcca cccgcatgat cggtggcctg atcatggctc acggcgacga caacggcctg       840
     cgggtgccgc ccgtgctcgc gcccacccag gtagtggtgc tcccggtccg cgacgacgac       900
     gccgtggtca cgaaggcccg cgagatcacc gacgcgctca ccgcactcgg cgtccgggcc       960
     aggctggacg cccgccccgg tctgtcgttc ggccgccggg tcaccgacgc cgagctcaag      1020
     ggcatccccg tccgggtcga ggtcgggccg cgcgacctgg ccgccggcaa cgtcacgctg      1080
     gcccgccggg acaccgccga gaagttcccg gtgccgctcg gtgaagccgc cggccgtgtc      1140
     cccgtcctgc tcgacgaggt gcaagcgagc ctgtacgcac aggccctggc gctgcgcgac      1200
     gagcgcacct cggacgtcac ctcgctgacc gaggcggtcg aggccgccgc gacgggcttc      1260
     gcccggctgc cctggcgcct ggtaggtgag gacggcgagg cacggctcgc cgaggactcg      1320
     ctgaccgtcc gctgcctgca gacgccggac ggcgccctgc cgaccgcgga caccagggac      1380
     gaggatctcg tctgcctcgt ggcccgcgcc tactga                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page