(data stored in ACNUC7421 zone)

EMBL: CP000820.PE347

CP000820.PE347       Location/Qualifiers
FT   CDS_pept        418902..419234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09816"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF71"
FT                   /protein_id="ABW09816.1"
FT                   /translation="MSRAGSETGVFSASWSRRRDLVPAVGLTGGAGGSVGQPVPAGPVR
FT                   RAERGRRHPVLAVTGDRTRHERSATRWRRLAAPSPSSREFRVVPWRARMRPEGRRRRRD
FT                   VRSGRA"
     gtgtcgcggg cgggatcgga gacaggtgtg ttcagcgcga gttggtcccg ccggcgggac        60
     ctggtcccgg ctgtcgggct gaccggtgga gctgggggtt ccgtcggaca gccggtgccg       120
     gccgggcctg ttcggcgggc ggagcgcggt cggcgacacc cggtgcttgc ggtgaccggc       180
     gaccgaactc gacatgaacg atcggcgacg cgatggcgac ggctggcagc gccgtcgccg       240
     agctcgcggg agttccgggt ggttccctgg cgagcccgga tgagaccgga ggggcgtcgt       300
     cgtcgccgtg acgtgcgttc gggccgagcc tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page