(data stored in ACNUC7421 zone)

EMBL: CP000820.PE349

CP000820.PE349       Location/Qualifiers
FT   CDS_pept        420297..421421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0352"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="TIGRFAM: phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: fal:FRAAL6535
FT                   high-affinity phosphate transport protein (ABC
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09818"
FT                   /db_xref="GOA:A8LF73"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF73"
FT                   /protein_id="ABW09818.1"
FT                   /translation="MDEGLLVNLGKRQIVAGLAAAALLSLAACGSDDNTDTADGTAPTA
FT                   SAGAIDCAKGSITGSGSSAQKNAMDEWVSAYQDACDGATINYQGSGSSTGRQQFIDKQV
FT                   TFAGSDSALKDAQKTAADARCTGGAAVDIPMVVGPISLIYNLDGVDKLNLSPSAIAKIF
FT                   SGAITKWNDPAIAADNSGVSLPDAPIQAVHRSDGSGTTDNFTKFLKGAAASDWTFEGGS
FT                   DWTAPGGQGAKGSDGVTSTVKSTPNAIGYVELSYAENASLPTALVGNASDEFIAASTDA
FT                   ASIGISSAKVADGDDLKLTFDYTTATKGAYPIYLATYEIVCTAGTPADQAPLLKSFLTY
FT                   IASADGQAAIGDLGYAPLPDEIATKVRGVIAKIA"
     atggacgaag gattgctagt gaacctaggc aagcgtcaga tcgtcgcggg cctcgccgcc        60
     gcggcgctgc tctctctggc cgcgtgtggc tcggacgaca acaccgacac cgcggacggg       120
     accgcgccca cggcctccgc cggcgcgatc gactgcgcca aggggtcgat caccgggtcg       180
     gggtcctccg cgcagaagaa cgcgatggac gagtgggtct cggcctacca ggacgcctgt       240
     gacggcgcca ccatcaacta ccagggctcc ggctcgtcga cgggacgcca gcagttcatc       300
     gacaagcagg tcaccttcgc ggggtccgac tccgcactga aggatgccca gaagaccgcg       360
     gcggacgccc gctgcaccgg cggcgcggcc gtcgacatcc cgatggtcgt cgggcccatc       420
     tcgctcatct acaatcttga cggtgtcgac aagctgaacc tcagcccgtc ggccatcgcg       480
     aagatcttct ccggtgcgat caccaagtgg aacgacccgg cgatcgccgc cgacaactcc       540
     ggcgtcagcc tgccggacgc tcccatccag gcggtccacc gctcggacgg ctcgggcacg       600
     acggacaact tcaccaagtt cctcaagggc gccgcggcgt ccgactggac cttcgagggc       660
     ggctccgact ggaccgcgcc gggtggccag ggcgccaagg gcagtgacgg tgtgacctcg       720
     accgtcaagt ccaccccgaa cgcgatcggc tacgtcgagc tctcctacgc ggagaacgcc       780
     agcctgccga ccgcgctggt cggcaacgcc tccgacgagt tcatcgcggc gagcaccgac       840
     gccgcctcga tcggcatcag ctccgccaag gtcgccgacg gcgacgacct caagctcacc       900
     ttcgactaca ccacggcgac caagggtgcc tacccgatct acctggccac ctacgagatc       960
     gtctgcaccg ccggcactcc cgccgaccag gctccgctcc tcaagagctt cctgacctac      1020
     atcgcgtccg cggacggcca ggccgcgatc ggtgacctcg gctacgcccc gctgccggac      1080
     gagatcgcca cgaaggtccg cggcgtcatc gccaagatcg cctga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page