(data stored in ACNUC7421 zone)

EMBL: CP000820.PE35

CP000820.PE35        Location/Qualifiers
FT   CDS_pept        43699..44568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0036"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   fal:FRAAL0518 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09504"
FT                   /db_xref="GOA:A8LB43"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB43"
FT                   /protein_id="ABW09504.1"
FT                   /translation="MPSTPGPTVRRRCLGAELRRLREAKELTVDQAGEHIHRSGPTISR
FT                   METGQFRFVLRNVSDLLDLYGVTDDEQRQALLALVKENRRPAWWHSYGDLVPRWFQVYI
FT                   GLEAEASTITTFESLLVPGLLQTEDYARAVIRAASPELPAHEVDRAVEVRMNRQKILTG
FT                   DQPVQLWAILDEAVIRRHVGNPTVMARQLDRLIEAAEQPAVTIQVVPFTAGAHAGMIAS
FT                   FTILGFPDTGGASETVYIEAPTGSLYLEKQAEVRRYEAWMNQLRSSALAPTPNTLSIIK
FT                   AAREDLQR"
     atgccgagca caccaggccc caccgtgcga cgccggtgcc tgggcgcgga gctgcgccgc        60
     ctgcgggaag ccaaggaact gaccgtcgac caggccgggg aacacatcca ccgcagcggg       120
     ccgacgatca gccggatgga gaccggccag ttccggttcg tcctgcgtaa cgtctcggac       180
     ctgctcgatc tctacggcgt caccgacgac gagcagcgcc aagccctgct ggcgctggtg       240
     aaggagaacc gcagacccgc ctggtggcac tcctacggcg atctcgtgcc ccgctggttc       300
     caggtctaca tcggcctgga agccgaagcc tccacgatca cgaccttcga gagcctgctc       360
     gtccccggcc tgctccagac cgaggactac gcacgcgcgg tcatccgcgc cgcctcaccc       420
     gagctacccg cccacgaagt cgaccgggcc gtcgaagtcc ggatgaaccg gcagaagatc       480
     ctcaccggag accagcccgt gcaactctgg gcgatcctcg acgaagccgt gatccgccgc       540
     cacgtcggaa accccaccgt catggcccgc cagctggacc ggctcatcga agcggccgag       600
     caacccgccg tgacgatcca ggtcgtgccg ttcaccgcgg gcgcccacgc cggcatgatc       660
     gcaagcttca cgatcctggg cttccccgac actggcggag cctccgagac ggtctacatc       720
     gaagctccca cgggcagcct ctacctggag aaacaagccg aggtccgacg ctacgaagcc       780
     tggatgaacc agctccgcag ctccgccctc gcacccaccc ccaacaccct ctcgatcatc       840
     aaagcggcac gtgaggacct acaacgatga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page