(data stored in ACNUC7421 zone)

EMBL: CP000820.PE350

CP000820.PE350       Location/Qualifiers
FT   CDS_pept        421590..422741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0353"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: fal:FRAAL6534
FT                   high-affinity phosphate transport protein (ABC superfamily,
FT                   membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09819"
FT                   /db_xref="GOA:A8LF74"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF74"
FT                   /protein_id="ABW09819.1"
FT                   /translation="MTTEPGSPADAGSRGTGSPTTPEAATAPAAEAAPTSTTSTDITAA
FT                   GATPPGATPPGTTPPELVPPDITPPADAKPKVGLADVVFKNLTRTAGVSLLVLIALIAI
FT                   FLVLRATDALSANTGNFLTTEEWRANADPPVFGVAALLFGTLVSAVGALIIAVPVAVGI
FT                   ALFITIYAPRRLASGLGFIVDLLAAVPSVVYGLWGLIVLAPHFNGTQSWLADYFGWIPL
FT                   FDTGAGTVGRSMFLASVVLAIMILPIVAAISREVFSQVPITHREAALALGATRWEMIRT
FT                   AVIPYGKPGVISASMLGLGRAMGETIAVALVLPASFDISWKILTPAGNTIAANVANGFG
FT                   EANDIGKGALIASGLVLFVVTMVVNMIARAVIARRREFSGRAA"
     atgacgactg agccgggtag cccggccgac gccgggtctc gggggaccgg ttcaccgacc        60
     accccggagg cggccaccgc accagcggcg gaggccgcgc cgacgagcac cacgtcgacg       120
     gacatcacag cggcgggcgc gacaccgccg ggcgcgacac cgccgggcac aacgccgccg       180
     gaactcgtgc caccggacat cacaccgccg gcggacgcca agccgaaggt cggcctggcc       240
     gacgtcgtgt tcaagaacct gaccaggacg gcgggcgtca gcctgctcgt gctcatcgcg       300
     ctgatcgcga tcttcctggt gctgcgggcc accgacgccc tgagcgcgaa caccgggaac       360
     ttcctcacca cggaggaatg gcgggccaac gccgacccgc ccgtcttcgg tgtcgcagcc       420
     ctcctgttcg gaactctggt ctccgccgtg ggggcactga tcatcgcggt tccggtcgcg       480
     gtcggaatcg cgcttttcat cactatctac gcgcctcgtc ggctggcctc cgggctcggt       540
     ttcatcgtcg acctgctcgc ggccgtgccg agcgtcgtct acggtctctg gggcctgatc       600
     gtcctcgctc cgcacttcaa cgggacgcag tcctggctgg ccgactactt cggttggatc       660
     ccgcttttcg acaccggtgc gggcacggtc ggccggtcga tgttcctggc cagcgtggtg       720
     ctggcaatca tgattctccc gatcgtggcg gcgatttccc gggaggtctt ctcccaggtt       780
     cccatcacgc atcgtgaggc cgctctggcg ctcggcgcaa cccgctggga gatgatccgg       840
     actgcggtca ttccctacgg caagccgggt gtgatcagcg cttccatgct gggcctcggc       900
     cgggctatgg gcgagacgat cgcggtggcc ctcgtcctgc ccgcctcctt cgacatctcc       960
     tggaagatcc tcactcccgc cggaaacacg atcgccgcga atgtggcgaa cggcttcggt      1020
     gaggcaaacg acatcggaaa gggcgctctc atcgcgtccg gtctcgttct cttcgtcgtc      1080
     acgatggtgg tcaacatgat tgctcgagcc gtcatcgcgc ggcgtcgcga gttctcgggg      1140
     cgcgccgcat ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page