(data stored in ACNUC7421 zone)

EMBL: CP000820.PE352

CP000820.PE352       Location/Qualifiers
FT   CDS_pept        423907..424683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0355"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: fal:FRAAL6532 high-affinity phosphate
FT                   transport protein (ABC superfamily, atp_bind); TIGRFAM:
FT                   phosphate ABC transporter, ATPase subunit; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09821"
FT                   /db_xref="GOA:A8LF76"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF76"
FT                   /protein_id="ABW09821.1"
FT                   /translation="MATRIDISGLTAYYGKFKAVADVNLTIEPKTVTAFIGPSGCGKST
FT                   VLRTLNRMHEVLPGARVEGKVLLDGEDLYGPGVDPVNVRRNVGMVFQRPNPFPTMSIYE
FT                   NVIAGLKLNGVRKKALLDERVEESLRGANLWDEVKDRLNRPGAGLSGGQQQRLCIARAI
FT                   AVEPQVLLMDEPCSALDPISTLAIEDLIQKLRSSYTIVIVTHNMQQASRVSETTAFFSL
FT                   EKTGDPGRLVECDRTSQIFSNPKEKRTEDYVSGRFG"
     atggccaccc gtatcgacat ctccgggctg accgcctact acgggaagtt caaggccgta        60
     gccgacgtga acctgacgat cgagcccaag accgtgacgg ccttcatcgg cccgtccggc       120
     tgcgggaagt cgaccgtcct gcggacgctc aaccggatgc acgaggtcct ccccggtgcc       180
     cgggtcgagg gcaaggtcct gctcgacggg gaggacctgt acggacccgg ggtcgacccg       240
     gtgaacgtcc gccgcaacgt cggcatggtc ttccagcggc ccaacccgtt ccccacgatg       300
     tcgatctacg agaacgtcat cgccgggctg aagctgaacg gcgtccgcaa gaaggcgctg       360
     ctcgacgagc gggtcgagga gtcgctgcgc ggcgccaacc tgtgggacga ggtcaaggac       420
     cggctcaacc ggcccggcgc cgggctgtcc ggaggccagc agcagcgact gtgcatcgcc       480
     cgcgcgatcg ccgtcgagcc gcaggtgctg ctcatggacg agccgtgctc cgcgctcgac       540
     ccgatctcca ccctcgcgat cgaggacctg atccagaagc tccggtccag ctacacgatc       600
     gtcatcgtca cgcacaacat gcagcaggcg tcccgcgtga gcgagacgac ggccttcttc       660
     tccctggaga agaccggcga cccgggacgg ctggtggaat gcgaccgcac ctcgcagatc       720
     ttcagcaacc cgaaggagaa gcgcaccgag gactacgtct ccgggcggtt cggctga          777
//

If you have problems or comments...

PBIL Back to PBIL home page