(data stored in ACNUC7421 zone)

EMBL: CP000820.PE353

CP000820.PE353       Location/Qualifiers
FT   CDS_pept        424695..425768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0356"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: fal:FRAAL6531 putative
FT                   two-component system, regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09822"
FT                   /db_xref="GOA:A8LF77"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF77"
FT                   /protein_id="ABW09822.1"
FT                   /translation="MWPTASGGGDGAVAPAAPDHGQPSPWLLIADDEANDELLPALRGR
FT                   GVEVSVVTDGAQALVEIGRLDPSAVLISARLPVVDGVTVIRTVRSVAGRDTTPILFAVG
FT                   PGDREQAAAALEAGASACVGKPYRLHEVLAMVGAVGGLAAVTAGLGAPGGLGAPGGLSG
FT                   SGTRMTPAAGRAGSFGGPEGAGGFGAGPEHVGGIGGLLAAGGPGRPGLAGALTVPAASS
FT                   VLRSGPVVLDVDAHEVTVDGRAVHMPPREFRLLHLLLGHAGRVVTRETLLTEVWGSADT
FT                   DPNTLAVHVRRLRRRLGDSISGAADGAAQRHDSADAPSVSSRPVVTSRGLIDVHPPLIE
FT                   SIRGIGYRFRAPAPRPT"
     gtgtggccga cggccagcgg cgggggcgac ggtgcggtcg cccccgccgc gccagatcac        60
     ggacagccct cgccctggct gctcatcgcc gacgacgagg cgaacgacga actgctaccg       120
     gcattgcgcg gccggggcgt ggaggtcagc gtcgtcaccg acggcgccca ggccctcgtc       180
     gagatcggtc ggctcgaccc gtcggccgtg ctgatcagcg cacggctgcc ggtggtggac       240
     ggcgtcaccg tgatccgcac ggtccgctcc gtggcgggcc gggacactac gcccatcctg       300
     ttcgcggtcg gccccggtga ccgggaacag gccgcggcgg cgctcgaggc cggggcgagc       360
     gcctgcgtgg gcaagccgta ccgcctgcac gaggtgctgg cgatggtcgg tgccgtcggc       420
     ggcctggcgg ccgtcacggc cggcctgggc gccccgggcg gtctgggcgc cccgggcggt       480
     ctgagcggtt caggcacccg gatgacgccg gccgcgggcc gcgccggctc gttcggaggc       540
     ccggagggcg ccggcggctt cggcgccggg ccggagcacg tcggcggcat cggcgggctc       600
     ctcgccgccg gcgggccggg ccggccaggg ttggccggcg cgttgacggt ccccgcggca       660
     tcgagcgtgc tgcgctccgg gccggtcgtt ctcgacgtcg acgcgcacga ggtcaccgtg       720
     gacggccgcg ccgtccacat gccgccacgg gagttccggc tgctgcacct gctgcttggg       780
     cacgccgggc gggtcgtcac cagggagacc ctgctcaccg aggtctgggg ctcggccgac       840
     accgacccga acacgctggc ggtgcacgtg cgccgcctgc gccgccgcct cggggattcc       900
     atctccggcg cggccgacgg cgccgcgcag cgacacgact ccgccgacgc tcccagcgtg       960
     tcgtcgcgcc cggttgtgac ttcccgtggc ctcatcgacg ttcatccgcc gcttatcgag      1020
     agcatccgcg ggatcggata tcgctttcgg gcccccgctc cgcgcccgac ctga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page