(data stored in ACNUC7421 zone)

EMBL: CP000820.PE354

CP000820.PE354       Location/Qualifiers
FT   CDS_pept        complement(425875..426786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0357"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: helix-hairpin-helix motif; HhH-GPD family
FT                   protein; KEGG: fal:FRAAL6530 A/G-specific adenine
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09823"
FT                   /db_xref="GOA:A8LF78"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF78"
FT                   /protein_id="ABW09823.1"
FT                   /translation="MGGVPRLETIPAMTSVRMADEVLEWFAVCARDLPWRRPETTPWGV
FT                   LVSEIMLQQTPVNRVLPVWAEWLSRWPAPADLAAEPSGEAVRAWGRLGYPRRALRLHQA
FT                   ATAMLERHGGAVPDELDDLLALPGVGSYTARAVAAFAFRQRHAVIDVNVRRLVARAVEG
FT                   VAEGPTSVSRRDLALVADLLPADPETAARASAAFMELGALVCVARAPRCAACPVRDRCA
FT                   WLAVGSPPSEGPARRPQGYAGTDRQVRGRLLAVLREATGPVEQADLDAVWDEPVQRDRA
FT                   LAGLLTDGLVSRTAPGVYALPR"
     gtgggcggtg tgccgaggct tgagacgatt cccgcgatga catccgtgcg aatggctgac        60
     gaggtgctgg agtggttcgc ggtctgtgcc cgcgacctgc cctggcggcg gcccgagacg       120
     acgccgtggg gcgtcctcgt cagcgagatc atgttgcagc agacgccggt caaccgggtc       180
     ctgccggtct gggcggagtg gctcagccgc tggccggcac cggccgacct cgccgcggag       240
     ccctccggtg aggccgtgcg ggcgtggggg cgcctcggct accctcgccg ggctctgcga       300
     ctgcaccagg ccgccaccgc gatgctggaa cggcacggcg gcgccgtccc ggacgagctt       360
     gacgacctgc tggcactgcc cggtgtcggg agctacacgg ccagggccgt ggcggcgttc       420
     gccttccggc agcgccacgc cgtgatcgac gtgaacgtcc gccgcctggt cgcccgggct       480
     gtcgaggggg tcgccgaggg gccgacgtcg gtctcccggc gcgacctcgc gctggtcgcc       540
     gacctgctgc cagcggaccc ggagaccgcg gcgcgggcga gcgcggcgtt catggagctg       600
     ggcgcgctgg tctgcgtggc ccgggcgccc cgctgcgccg cgtgccccgt ccgggacagg       660
     tgcgcgtggc tggcggtcgg cagcccgccc tccgagggcc cggcccggcg cccgcagggc       720
     tacgccggga ccgaccgcca ggtgcgcggc cgcctgctgg ccgtgctccg ggaggcgacc       780
     gggccggtcg agcaggccga cctcgacgcg gtgtgggacg agcccgtcca gcgcgaccgg       840
     gcgctcgccg ggctcctcac ggacggcctg gtcagccgga cggcgccggg cgtctacgcc       900
     cttccacgct ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page