(data stored in ACNUC7421 zone)

EMBL: CP000820.PE355

CP000820.PE355       Location/Qualifiers
FT   CDS_pept        complement(426847..427926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0358"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: helix-hairpin-helix motif; protein of unknown
FT                   function DUF147; KEGG: fal:FRAAL6529 nucleic-acid-binding
FT                   protein protein, containing HHH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09824"
FT                   /db_xref="GOA:A8LF79"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LF79"
FT                   /protein_id="ABW09824.1"
FT                   /translation="MAGPPGDDIFRATLAAVAPGTPFRDGLERILRGHTGALIVLGHDK
FT                   VVEGLCTGGFELDVEFSATRLRELAKMDGAIVLSSDLARIVRAAVHLVPDPTVPTEESG
FT                   TRHRTAERVAKQTGFPVISVSQSMHIIALYVAGRRYVLDGAAAILSRANQALATLERYK
FT                   LRLDEVAGTLSALEIEDLVTVRDAISVSQRLEMVRRIADEIESYVVELGTDGRLLSLQL
FT                   EELMAGVETERELTVRDYLPVGSRAGNAAQVLAELSAMSPTDLLDLTVIARVIGFSGGA
FT                   DILDRQISPRGYRMLAKVPRLPRMVVDRLVDHFSTLQKLLAAGVDDLQAVDGVGETRAR
FT                   AVREGLSRLAESSILERYV"
     atggcaggac cacccgggga tgacatcttc cgggcgacac tcgccgcggt cgcgcccggt        60
     accccgttcc gtgacggtct cgagcgcatc ctgcgtgggc acaccggagc gctcatagtg       120
     ctcggccacg acaaggtcgt cgagggcctg tgcaccggcg gattcgagct cgacgtggag       180
     ttctcggcca cccgcctgcg cgagctggcg aagatggacg gcgcgatcgt gctctcctcc       240
     gacctcgcgc ggatcgtacg ggccgccgtg cacctcgtcc cggatcccac ggttccgacc       300
     gaggagtccg gcactcggca ccgcaccgcg gagcgggtcg cgaagcagac cggcttcccc       360
     gtgatctcgg tcagccagtc gatgcacatc atcgccctgt acgtggcggg gcggcggtac       420
     gtgctcgacg gcgccgcggc catcctctcc cgcgccaacc aggcgctggc cacgctcgaa       480
     cgctacaagc tgcgcctcga cgaggtcgcc ggcaccctct cggcgctgga gatcgaggat       540
     ctggtcaccg tccgtgacgc tatctcggtg agccagcggc tggagatggt ccggcggatc       600
     gccgacgaga tcgagagcta cgtcgtcgag ctcgggacgg acggccggct gctgtcgctg       660
     cagctcgagg agctgatggc cggcgtcgag accgagcgcg agctcaccgt gcgcgactac       720
     ctgccggtcg gctcgcgggc gggcaacgcc gcccaggtgc tcgccgagct gtccgcgatg       780
     tcaccgacgg acctgctcga cctgaccgtc atcgcccggg tgatcggctt ctccggcggg       840
     gcggacatcc tcgaccgcca gatcagcccg cgtggctacc ggatgctggc caaggtcccg       900
     cgcctgccgc ggatggtggt ggaccgcctc gtcgaccact tcagcaccct gcagaagctg       960
     ctcgccgccg gggtcgacga cctccaggcg gttgacggcg tcggtgagac ccgcgcccgc      1020
     gcggtccgtg aggggctctc ccggctcgcg gagtcgagca tcctcgaacg ctacgtctga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page