(data stored in ACNUC7421 zone)

EMBL: CP000820.PE362

CP000820.PE362       Location/Qualifiers
FT   CDS_pept        433843..434235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0365"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: fal:FRAAL6522 hypothetical protein;
FT                   putative oxidoreductase; putative FMN-binding split barrel
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09831"
FT                   /db_xref="GOA:A8LF86"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF86"
FT                   /protein_id="ABW09831.1"
FT                   /translation="MAARLPESVRALADAPTYVTLATIRPDGSPRLTVLWIARDGDELL
FT                   LSTVRGRAKERDIARDQRVGLMFLDQRDPYSYVEVRGLATLSEEGGKELIDQLATKYTG
FT                   SPYQWDGPDEVRLVIRVVAERVLTTG"
     atggcggcgc ggcttcccga gtcggtcagg gcgctcgcgg atgctccgac atacgtgacg        60
     ctggcgacga tccgtcccga cggctcgcct cgcctgaccg tgctgtggat cgcccgggac       120
     ggcgacgagc tgctcctgtc gaccgtgcgc gggcgcgcga aagagcgtga catcgcgcgt       180
     gaccagcggg tcgggctgat gttcctcgat cagcgggacc cgtacagcta cgtggaggtc       240
     cgcgggctgg ccacgctctc cgaggagggc ggcaaggagc tcatcgatca gctcgccacc       300
     aagtacaccg ggtccccata ccagtgggac ggtccggatg aggtccggct ggtgatccgg       360
     gtggtcgcgg agcgcgttct caccaccggc tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page