(data stored in ACNUC7421 zone)

EMBL: CP000820.PE364

CP000820.PE364       Location/Qualifiers
FT   CDS_pept        complement(435972..437561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0367"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   fal:FRAAL6520 hypothetical protein;putative SMAD/FHA
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09833"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF88"
FT                   /protein_id="ABW09833.1"
FT                   /translation="MSARCPEGHLSHDPDYCDQCGLRIVGGQERYGYRQDDAGRGAAYS
FT                   AGAPTGRPADPYGRRTPERDPSVPPGPSGPAGAPGGYDPLGIRRAPADAPGVADPPRGA
FT                   GRGGDPYGGYGREGYAEEPRSGRSYPAADPYNRDGYGRPADERGRPDERARPDGRGERP
FT                   REGLDPYGRERDDRGPGGRDDRTPPGYGRDDRGGAGGFGGGRGEPDPAGYPRARDDRGG
FT                   YGAPDGRGGYGPGEPGRPAPEADDRRGYRDDGYGPNGGGYGADPLGVSAAGATPVPAPA
FT                   GTRDRGADRYAPAPCPNCRSLNEPSARFCETCGLDFSTGQLPAPAGAVPVDDAGVTSRQ
FT                   TGSRRGAEARHSTDPRMADPRRADPRLDDPRLGDPRAADPRMGGDPRAGSRGREWDEAG
FT                   PGGTWEAVVEAEREYYDSGDDHRVPFPAFYPRRVFVLTESQMLIGRRSESRGIHPEIDL
FT                   SGAPEDPGISRAHATLERMPDGTYAVRDPGSTNGTRLNDEPDPIEPGRPIPLRDGDRVY
FT                   VGAWTRITVRAQ"
     gtgagcgcac gctgcccgga ggggcacctg tcgcacgatc ccgactactg cgatcagtgc        60
     gggctgcgga tcgtgggtgg tcaggagcga tacggctacc gtcaggacga cgccgggcgc       120
     ggcgccgcgt acagcgcggg cgcgccgacg gggcgtccgg cggacccgta cgggcgtcgg       180
     acgccggaac gggacccctc ggtgcccccg gggccttcgg gccccgccgg agcgccggga       240
     ggctatgacc cgctcggcat ccggcgcgcc ccggccgacg cgccaggcgt ggcggatccg       300
     ccacgtggcg ccggccgcgg cggcgacccc tacgggggct acggccgcga gggatacgcc       360
     gaggagccgc gctccggacg gtcgtacccg gcggcggacc catacaaccg cgacgggtac       420
     gggcgccccg ccgacgagcg gggccggccc gacgaacggg cccggcccga cggccgcggt       480
     gagcggccgc gggaggggct cgacccctac ggccgtgagc gcgacgatcg cggccccggc       540
     ggtcgcgatg accgcacccc gcccggatac gggcgggacg accgcggcgg tgccggcggc       600
     ttcggcggcg ggcgtggcga gccggatccc gccggctacc ctcgcgcccg cgacgaccgc       660
     ggcgggtacg gcgcgcccga cgggcggggc ggctacggcc ccggcgagcc gggccggccg       720
     gcgcccgagg ccgacgaccg gcgcggctac cgtgacgacg gctacggccc gaacggcggc       780
     ggctacggcg cggacccgct cggcgtgtcg gccgccggcg cgaccccggt accggccccg       840
     gccggcaccc gcgaccgcgg cgccgaccgc tatgcccccg ccccctgccc gaactgccgc       900
     tcgctgaacg agccgtccgc gcggttctgc gagacctgcg ggctcgactt cagcaccggc       960
     cagctgcccg ctccggcggg cgcggtgccc gtcgacgacg cgggcgtgac ctcccggcag      1020
     accgggtcac ggcgcggcgc cgaggcccgc cactccaccg acccgcggat ggccgacccg      1080
     cgccgcgccg acccgaggct cgacgatccc cggctcggcg acccgcgcgc ggccgatccc      1140
     cggatgggcg gcgacccgcg agccggctcc cgtggccgcg agtgggacga ggccggtccc      1200
     ggcggcacgt gggaggccgt cgtcgaggcg gaacgcgagt actacgacag cggtgacgac      1260
     caccgcgtgc cgttccccgc gttctacccg cgccgcgtct tcgtcctgac cgagtcgcag      1320
     atgctgatcg gccggcgcag cgagtcgcgc ggcatccacc ccgagatcga cctctcggga      1380
     gcaccggagg acccgggcat ctcccgggcg cacgcgaccc tggagcggat gcccgacggc      1440
     acgtacgccg tgcgtgaccc cggctcgacg aacggaaccc gcctcaacga cgagccggac      1500
     ccgatcgagc ccggccgtcc gatccccctg cgcgacggcg accgcgtcta cgtgggtgcc      1560
     tggacgagga tcaccgtccg cgcgcagtaa                                       1590
//

If you have problems or comments...

PBIL Back to PBIL home page