(data stored in ACNUC7421 zone)

EMBL: CP000820.PE366

CP000820.PE366       Location/Qualifiers
FT   CDS_pept        complement(438959..440494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0369"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="SMART: protein phosphatase 2C domain protein; KEGG:
FT                   fal:FRAAL6518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09835"
FT                   /db_xref="GOA:A8LF90"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF90"
FT                   /protein_id="ABW09835.1"
FT                   /translation="MDLNPRHGQGYPGHGYPPERPDSPHPNAGYAENSTHPDGYPGDDL
FT                   PTESYRAEDFRADDQPTESYTPDQFTGSAYPESGYADNGYAENSYPDGAYPGAGYPAGT
FT                   GDYREGDYHHEYPESAYSEPGYQGETYSDDTYSGSGFNEDGYAEDTDPATMLLGQRAVP
FT                   GEADDDAHDEVMRCPVCAAPNYQDARYCEACGFALTGVPVAGGDEDHREIDLGPLAGVC
FT                   DRGVRHTTNEDSMGVAIVHGTLIAVVCDGVSTTPGSGEASAAAAATATAILADAVRAHG
FT                   PGEAVPYDERPASRANDVLDVLEEYSEYDEPRTAPRRISGGFGPDEADIALQRAVEAAQ
FT                   ATIAQLSAAEGRMAPSCTFAAAIITPPSVDGPGMVTVGWVGDSRVYLLGPRWCERLTAD
FT                   DTWAAEAARAGLIPASEAETHRRAHTLTRWLGGDAEDVTPHTAAFPIETPATVLVCSDG
FT                   LWNYSSRPDVLAALVNQLEPSASALDVSRHLIDFAIDQGGHDNITVVAARVTS"
     gtggacctca acccccggca cgggcagggc taccccgggc acggctatcc ccccgaacgc        60
     ccggactcgc cgcacccgaa tgccggctac gccgagaact ccacccaccc cgacggatac       120
     ccaggtgacg atcttccgac cgagagctac cgggcggagg acttccgagc cgatgatcag       180
     cctaccgaga gctacacgcc ggaccagttc accgggtcgg cctacccgga gagcggctac       240
     gccgacaacg gctatgcgga gaactcctat ccggacggcg cctatcccgg cgccggctac       300
     ccggcgggca cgggtgacta ccgggaaggc gactatcacc acgagtaccc cgaatccgcg       360
     tactccgaac ctggctacca gggtgagacg tactcggacg acacctattc gggcagcgga       420
     ttcaacgagg acggatacgc ggaggacacc gatccggcca cgatgctcct gggccagcgc       480
     gccgtcccgg gcgaggcgga cgacgacgcg cacgacgagg tgatgcgctg cccggtgtgc       540
     gcggcaccca actaccagga cgcccggtac tgcgaggcct gcggtttcgc cctgaccggc       600
     gtcccggtgg ccggcggcga cgaggaccac cgcgagatcg acctcggccc gctcgccggc       660
     gtgtgtgacc gcggcgtgcg gcataccacc aacgaggact cgatgggcgt ggcgatcgtc       720
     cacggcacgc tgatcgcggt ggtctgcgac ggggtctcga cgaccccggg ctccggggag       780
     gcgtccgccg ccgccgcggc gaccgcgacg gccatcctcg ccgacgcggt gcgcgcccac       840
     gggcccggcg aggccgtccc gtatgacgag cggccggcga gccgggcgaa cgacgtcctc       900
     gacgttctgg aggagtactc cgagtacgac gagccgcgca ccgctccgcg gcggatctcc       960
     ggtggtttcg gcccggacga ggccgacatc gccctgcagc gggccgtgga ggccgcccag      1020
     gccacgatcg cccagctcag cgcggcggag ggccggatgg cgccgtcctg caccttcgcg      1080
     gcggcgatca tcacgccgcc gtcggtggac ggtcccggca tggtgaccgt cggctgggtc      1140
     ggcgacagcc gcgtctacct gctcggcccg cgctggtgcg agcggctcac cgcggacgac      1200
     acctgggcgg ccgaggcggc ccgggccggg ctcatcccgg cgtcggaggc ggagacccac      1260
     cggcgcgcgc acacactgac gcgctggctc ggcggcgacg ccgaggacgt caccccgcac      1320
     accgccgcct tcccgatcga gaccccggcc accgtgctcg tctgcagtga cggcctgtgg      1380
     aactactcct cgcgcccgga cgtcctcgcc gcgctggtga accagctcga gccgagcgcg      1440
     tccgcgctgg acgtctcccg ccacctcatc gacttcgcca tcgaccaggg cgggcacgac      1500
     aacatcaccg tggtcgcggc gagggtgacg agctga                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page