(data stored in ACNUC7421 zone)

EMBL: CP000820.PE367

CP000820.PE367       Location/Qualifiers
FT   CDS_pept        complement(440618..441952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0370"
FT                   /product="serine/threonine protein kinase"
FT                   /note="SMART: serine/threonine protein kinase; KEGG:
FT                   fal:FRAAL3895 putative serine/threonine-protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09836"
FT                   /db_xref="GOA:A8LF91"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR031634"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF91"
FT                   /protein_id="ABW09836.1"
FT                   /translation="MTRGHSVRGRDQGTTREPAARCPVCAGPIGRGRLGLPARDRGFCP
FT                   RCRTPYSFAPPLRAGDVAGGYEIVECLAEGGPGPAGWVFSAVDLRGVAVAAETTGTGDP
FT                   ARPGDPTRPSGLACPGGPGSGGGVPGRLVVLKSVRRGGMRPPARLGLRPGRRLPPDPPL
FT                   RHPAIVETLGEVRHDGVVYAVMELVSGPSLADLLRSRRAARGGAPAPLPVPEAVAGVRR
FT                   LLSALEYVHDRGYVFCDLAPGNVVWGGDRVTLIDLQAIREPGRRGGTFHVTAGFDAPEL
FT                   TVSPPSVGSDLYALGRLLATAVLDFPNRASTYRYTLPAQEVDQVLARHEPLRRFLLRAT
FT                   AANPADRFARAADMARELAGIAVDGAAAPAVEAAAEARNRAPTREKVGEVAEVTESARG
FT                   EGVLETELRPIPGARASAGTEGGTEITGVDASGGSCHYSFRRTWI"
     gtgacccgcg gtcattcggt tcgcgggcgc gaccagggca caacgcgtga accggccgcg        60
     cgctgccccg tctgcgccgg gccgatcggc cgcgggcggc tcgggctgcc cgcccgggac       120
     cgcggcttct gcccgcgctg ccggaccccc tactccttcg cgcccccgct gcgcgccggg       180
     gacgtcgccg gcggctacga gatcgtcgag tgcctggccg aaggcggccc cgggcccgcc       240
     ggttgggtct tctcagcggt cgacctgcgc ggcgtggcgg tcgccgccga gaccaccggc       300
     acgggcgacc cggcacgtcc gggcgacccg acacgcccaa gtggcctggc atgcccgggt       360
     ggcccaggct ccggcggtgg cgtcccgggg cggctggtgg tgctcaagag cgtgcgccgc       420
     ggtgggatgc gcccgcccgc gcggctgggc ctgcgcccgg gccgccggct gccgcccgac       480
     ccgccgctgc ggcatccggc gatcgtcgag acgctgggcg aggtccgcca cgacggcgtc       540
     gtctacgcgg tgatggagct ggtgagcggc ccgtccctgg cggatctgct ccggtcccgg       600
     cgggcggcgc gcggcggggc gccggcgccg ctacccgttc cggaggcggt cgccggggtg       660
     cgtcggctgc tgtccgcgct ggagtacgtc cacgaccgcg ggtacgtctt ctgcgacctg       720
     gcaccgggaa acgtggtgtg gggcggcgac cgggtgacac ttatcgatct tcaggcgatc       780
     cgtgagcccg ggcggcgcgg cggcaccttc catgtgacgg ccggtttcga cgcccccgag       840
     ctgacggtga gccccccgtc ggtgggttcc gacctctacg ctctcggcag gctgttggca       900
     accgcggtac tcgacttccc gaacagagcg tcaacctacc gatacaccct tcccgcccag       960
     gaggtcgacc aggtgctggc tcggcacgaa ccgctgcgcc ggttcctcct tcgtgccacc      1020
     gccgccaatc cggcggaccg gttcgccagg gccgccgaca tggcccgcga gctcgccgga      1080
     atcgcggtgg acggcgccgc cgcgccggcc gtggaagccg ccgcggaggc gagaaacaga      1140
     gcgcccacta gggaaaaggt gggagaggtg gcagaggtta cggagagcgc ccgtggcgag      1200
     ggcgtactgg agacagagct ccggccgatc ccaggagcac gggcgagcgc tggcaccgaa      1260
     gggggcaccg agatcacggg cgtcgacgca tctggcggat catgccacta ttcatttcgg      1320
     cgtacttgga tttga                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page