(data stored in ACNUC7421 zone)

EMBL: CP000820.PE37

CP000820.PE37        Location/Qualifiers
FT   CDS_pept        45693..46814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0038"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: sen:SACE_2322
FT                   phage-related integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09506"
FT                   /db_xref="GOA:A8LB45"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB45"
FT                   /protein_id="ABW09506.1"
FT                   /translation="MVDRESVAGAAGLYLVAGVPLLRADEQVFAAMLEGWGSQQTARNL
FT                   AVGTVEGRVRAVRAFTRHAEAFPWAWTAAMVDEWCTDLRAVRNLRRSTLRNYQEAVRLF
FT                   CVYVTDPAYGWPVRCEQEFGAHPVQICHEWNTTVHAQQSESDPGKRAFTVDELQAFFDY
FT                   ADEQVSRIRAAGRKGWLPAFRDAVLFKVAYAYGLRRREVRMLDLADFGRNPHGPEFGDY
FT                   GVCQVRFGKASKGSPPKRRGVLTVWTWTPEILAEWVEEFRPLLAPQDCPALWPSERAPR
FT                   VALTQINARFSTYRDALGLDPALDVHSLRRSYVTHLIEDGYDALFVQQQVGHEHASTTA
FT                   IYICVSSDFRTRTLRRALDQTLAAALTPTEKAR"
     gtggtggatc gggagtcggt ggcgggcgcg gcggggctgt acctggtggc tggggtgccg        60
     ctgttgcggg cggatgagca ggtgttcgcg gcgatgctgg agggctgggg gagccagcag       120
     acggcccgca atctggcggt gggcacggtc gaggggcggg tccgcgcggt gcgggcgttc       180
     acccgacacg ccgaggcgtt tccctgggcc tggacggcgg cgatggtcga cgagtggtgt       240
     accgatcttc gggcggtgag gaacctgcgt cggtcgacgc tgcggaatta ccaggaggcg       300
     gtccggctgt tctgcgtcta cgtcaccgat cccgcctacg gttggccggt ccggtgtgag       360
     caggagttcg gcgcgcatcc ggtgcagatc tgccacgagt ggaacaccac ggtgcacgcc       420
     cagcagtccg agagcgaccc cggcaagcgg gcgttcacgg tcgatgagct gcaggcgttc       480
     ttcgactacg ccgacgagca ggtcagccgg atccgggcgg ctgggcgcaa gggctggctg       540
     ccggcgttcc gcgacgcggt gctgttcaag gtcgcctacg cctacgggct gcgtcgcagg       600
     gaggtgcgga tgctcgacct cgccgacttc ggccgcaacc cgcacggccc cgagttcggg       660
     gactacggcg tctgccaggt ccggttcggc aaggcctcga agggctcgcc accgaaacgg       720
     cgcggcgtgc tgaccgtctg gacgtggacc ccggagatcc tcgcggagtg ggtggaggag       780
     ttccggccgc tgctcgcccc gcaggactgc ccggcgctct ggccgtcaga acgggccccg       840
     cgggtcgcgc tcacgcagat caacgcccgg ttctccacct accgcgacgc gctcggcttg       900
     gacccggcgc tcgacgtcca ctcgctgcgc cgttcctacg tgacccatct gatcgaggac       960
     ggctacgacg cgctgttcgt ccagcagcag gtcggtcacg agcacgcctc gacgaccgcg      1020
     atctacatct gcgtgtcctc ggacttccgg acccgcaccc tgcgccgcgc gctcgaccag      1080
     accctggcgg cggccctgac gccgacggag aaggcgcgat ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page