(data stored in ACNUC7421 zone)

EMBL: CP000820.PE371

CP000820.PE371       Location/Qualifiers
FT   CDS_pept        complement(446517..447281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0374"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: stp:Strop_4382
FT                   regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09840"
FT                   /db_xref="GOA:A8LF95"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF95"
FT                   /protein_id="ABW09840.1"
FT                   /translation="MLTISQLASYAGVTVRAVRHYHAKGLLPEPERDHSGYRRYDAHAV
FT                   VELIRIRTLADAGVPLARVRELLAAGEEEFNTAVADIDQRLRAEIRERQRHRERIAQLA
FT                   AGDSLALPPEAVAYLDRMRELGLPDLMIGGERDSWILVAAQLPEHMPLYMKVKQQQLDD
FT                   PATVELYRDLAAMIGWEADDPRVAAVGDRLVALIEADAEGWENHDEVMPDELAQLLDSV
FT                   FLDSVPIARRLLERLEERGWRGWTKFERIQPK"
     atgctcacga tcagccagct ggcgtcgtac gccggcgtca ccgtgcgcgc ggtgcggcac        60
     taccacgcca agggtctcct gccggagccg gagcgcgacc actccggcta ccggcgctac       120
     gacgcccacg ccgtcgtcga gctcatcagg atccgtacgc tcgccgacgc cggcgtgccg       180
     ctcgcgcgtg tccgcgagct actggccgcg ggtgaggagg agttcaacac tgccgtcgcc       240
     gacatcgacc agcgcctgcg cgcggagatc agggagcggc aacggcaccg cgagcggatc       300
     gcgcagctgg cagccgggga cagcctggct ctgccgccgg aggcggtggc gtacctcgac       360
     cggatgcgtg agctcggatt gccggacctg atgatcgggg gcgagcggga ctcctggatc       420
     ctggtggccg cccaactccc cgagcacatg ccgctctaca tgaaggtgaa gcagcagcag       480
     ctcgacgacc cggcaacggt cgaactctac cgcgatctcg ccgcgatgat cggctgggag       540
     gcggacgacc cgcgggtggc ggccgtaggc gaccggctcg tcgccctcat cgaggccgat       600
     gccgaaggat gggagaacca cgacgaggtg atgcccgacg agctcgcgca gctcctcgac       660
     tcggtcttcc tcgactcggt cccgatcgcc cgtcggctcc tggaacggct cgaggagcgc       720
     ggctggcgcg gctggaccaa gttcgaacgg atccagccga aatag                       765
//

If you have problems or comments...

PBIL Back to PBIL home page