(data stored in ACNUC7421 zone)

EMBL: CP000820.PE375

CP000820.PE375       Location/Qualifiers
FT   CDS_pept        452989..454416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0378"
FT                   /product="diguanylate phosphodiesterase with GAF sensor(s)"
FT                   /note="PFAM: EAL domain protein; GAF domain protein; KEGG:
FT                   fal:FRAAL3921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09844"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF99"
FT                   /protein_id="ABW09844.1"
FT                   /translation="MSVFASGAGSQDPRDGRDGRDRRRGRDRRVGGRVRERTDEVARVL
FT                   DLARRHLGTDVAWLSRFTGDEQVIDLISGEGELVERLVGRQVEQEATYCARVLDGRLPA
FT                   VIPDARADQRTAALAVTRELGIGSYVGAPVYLDSGEVYGMLCALSTEPDPGLGDREARF
FT                   LGLLADVVADAVSALHRGGADDDHIRSVIAQVIARGGPVMVFQPVFDLPTHGLVGAEAL
FT                   ARFPTFPAPSGEPAGDLGEETGDQAGGAAGEEADDRTAAGPYFGDLPPDRWFAHAASVG
FT                   MGIDLELAAIRAAVAELPRFPRGLSLAVNASPATIASGRLGELLAATATDQLIVEITER
FT                   DGIHDLPSTLARLYELREMGVRIAVDNVGVAYASLRRLVQILPDVVKMNLWLTTDIGAD
FT                   AARRALVEALVHFSRQIGACLVAEGIQRANELRVLTAAGVDQGQGEFLGPPGPLPLPVH
FT                   GRCVPASHGPLVSARAS"
     gtgagtgttt tcgctagcgg ggctgggtcg caggacccac gtgacggccg tgacggccgt        60
     gaccgtcggc gtggccggga ccgtcgcgtc ggcggacggg tgcgcgagcg taccgacgag       120
     gtggcccggg tgttggacct ggcccgccgc cacctcggga cggacgtcgc ctggctgtcg       180
     cggttcaccg gggacgaaca ggtcatcgac ctgatctccg gggagggtga gctggtcgag       240
     cgcctggtcg gcaggcaggt cgagcaggag gcgacctact gcgcccgggt gctggacggg       300
     cggctgcccg ccgtcatccc cgacgctcgg gcggatcagc gcaccgccgc cctggccgtc       360
     acccgcgagc tgggcatcgg ctcgtacgtg ggcgcgcctg tgtacctcga cagcggcgag       420
     gtctacggca tgctgtgcgc gctgagcacc gagccggacc cgggcctggg cgaccgcgag       480
     gcccgcttcc tgggcctgct cgccgacgtc gtggcggacg cggtgtccgc cctgcaccgc       540
     ggcggggcgg acgacgacca catccggagc gtgatcgcgc aggtcatcgc ccgcggcggg       600
     ccggtgatgg tcttccagcc ggtgttcgac ctgccgacgc acggcctcgt gggcgccgag       660
     gcgctggccc gcttccccac cttccccgcg ccgtcggggg agccggccgg ggacctcggt       720
     gaggagaccg gtgaccaggc tggtggggcg gccggtgagg aggccgacga ccgcaccgcc       780
     gccggcccgt acttcggtga tcttccgccg gaccgctggt tcgcgcacgc cgcgtcggtc       840
     gggatgggaa tcgatctgga gctggcggcg atccgggccg cggtcgcgga gctgcccagg       900
     ttcccgcgcg ggctgtcgct cgcggtgaac gcgtccccgg cgaccatcgc gtccggccgc       960
     ctcggggagc tgctcgcggc cacggcgacc gaccagctga tcgtcgagat caccgaacgg      1020
     gacggcatcc acgacctgcc cagcacgctc gcccgcctct acgagctgcg ggagatgggg      1080
     gtacggatcg cggtggacaa cgtcggcgtc gcctacgcga gcctgcgccg gctggtgcag      1140
     atcctgccgg acgtcgtgaa gatgaacctc tggctgacca cggacatcgg tgccgacgcg      1200
     gcgcggcgcg cgctcgtcga ggcgctcgtg cacttctccc ggcagatcgg ggcgtgtctc      1260
     gtggcggagg gcatccagag ggcgaacgag ctgcgcgtgc tgaccgccgc cggtgtggac      1320
     caggggcagg gcgagttcct gggcccgccg gggccgctgc cgctgcccgt gcacggccgg      1380
     tgcgtcccgg cgagtcacgg gccgctggtg tccgcgcgcg cgtcctga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page