(data stored in ACNUC7421 zone)

EMBL: CP000820.PE383

CP000820.PE383       Location/Qualifiers
FT   CDS_pept        462141..463397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0386"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   KEGG: fal:FRAAL1974 putative two-component system sensor
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09852"
FT                   /db_xref="GOA:A8LFA7"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFA7"
FT                   /protein_id="ABW09852.1"
FT                   /translation="MAGPVDATPDQRTERPVAPPAGKEPVPDQPGAGAGVDARPEQVFA
FT                   LDNRTWRRVLFLLLNLPTGLVGFVFVVVWFSVGVGMAVTVVGLPLLTIGLVVTRALGTV
FT                   ERARARAILGLHIPTASRPRSASTGAFGRLWAAVADPVGWRHALYFVIRLPWVIVTFTV
FT                   TLVLLLVGWPVLPVVARALAAVDRAMISALLSPSDRMERRIRELEADRGVVVDTAAADL
FT                   RRIERDLHDGAQARLVALAMGLGLAREKLADDPDTAAKMVEEAHGEVKLALRELRDLAR
FT                   GIHPAILTDRGLPGAIPSLGMRCTVPVRVTVELDERPAPAIEGIVYFTAAELLTNISKH
FT                   SRASDALVDLRRVGDNLLLRITDDGRGGASLGRGSGLAGLTERLGAIDGTLIVDSPPGG
FT                   PTYIIAKVPWRDREQTQSG"
     gtggccggcc ccgttgacgc gaccccggac caacggaccg agcggcccgt ggccccgccg        60
     gccgggaaag agcccgttcc cgaccagccc ggggccgggg ccggggtgga cgccaggccc       120
     gagcaggtct tcgccctcga caaccggacc tggcggcggg tcctcttcct gttgctgaac       180
     ctgccgacgg gcctcgtcgg gttcgtcttc gtggtcgtct ggttctcggt cggcgtgggg       240
     atggcggtca cggtcgtcgg cctgccgctg ctgaccatcg gcctggtggt gacccgggcg       300
     ctcggcaccg tcgaacgggc ccgggcccgg gccatcctcg gcctgcacat tccgacggcg       360
     tcgcggccgc ggtcggcgtc cacgggtgcc ttcggccggc tgtgggccgc ggtggcggac       420
     ccggtcggct ggcggcacgc cctgtatttc gtgatccggc tgccatgggt gatcgtcacc       480
     ttcaccgtga cgctggtgct gctgctcgtc ggctggccgg tgctgccggt cgtggcccgg       540
     gcactggcgg ccgtcgaccg ggcgatgatc tcggcgctgc tctcgccgtc cgaccggatg       600
     gagcggcgga tcagggagct ggaggccgac cgcggcgtcg tcgtcgacac ggccgcggcc       660
     gacctgcggc gcatcgagcg ggatctgcat gacggcgcgc aggcgcggct ggtcgcgctc       720
     gcgatggggc tgggcctggc gcgggagaag ctcgccgacg acccggacac cgcggcgaag       780
     atggtcgagg aggcgcacgg cgaggtcaag ctggcgctgc gggagctgcg cgacctggcc       840
     cgcggcatcc atcccgcgat cctcaccgac cggggcctgc cgggcgcgat cccgtcgctg       900
     gggatgcgct gcacggttcc cgtccgggtg acggtcgagc tggacgagcg gccggcgccg       960
     gcgatcgagg gcatcgtcta cttcaccgcc gccgagctgc tcaccaacat cagcaagcac      1020
     agccgggcgt cggacgcgct ggtcgacctg cgccgggtcg gtgacaatct gctgctgcgg      1080
     ataaccgacg acggccgcgg gggcgcgagc ctcggccggg gcagcggcct ggcgggcctc      1140
     accgagcggc tgggcgccat cgacggcacg ttgatcgtgg acagcccacc tggcgggccg      1200
     acctacatca tcgcgaaggt gccgtggcgg gacagggaac agacacagtc gggctga         1257
//

If you have problems or comments...

PBIL Back to PBIL home page