(data stored in ACNUC7421 zone)

EMBL: CP000820.PE387

CP000820.PE387       Location/Qualifiers
FT   CDS_pept        468767..469177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0390"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   fal:FRAAL4396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09856"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFB1"
FT                   /protein_id="ABW09856.1"
FT                   /translation="MPRQPDLSFLLDRLRETVPDILCAVVLSSDGLLLATSTGIDRAAA
FT                   DQLAAVASGFDALARGAARQHGWGQVNKTMVDMENGYLFITAVGHSACLAVSSTADADV
FT                   GQIAYEMAHLVSRAGRFLTPELRNQMRAALPS"
     gtgccccgac agcctgacct gtccttcctg ctcgaccgac ttcgcgagac cgtgccagac        60
     attctctgcg cggtcgtcct gtcttccgac gggctgctgc tggccacgtc caccggcatc       120
     gaccgggccg cggccgacca gctcgcggcg gtcgcctccg gattcgacgc gctggcgcgc       180
     ggcgcggcgc ggcagcacgg ctggggccag gtcaacaaga ccatggtcga catggagaac       240
     ggctacctgt tcatcaccgc cgtgggccac agcgcctgcc tggcggtctc cagcacggcc       300
     gacgccgacg tcggccagat cgcctacgag atggcccatc tcgtcagccg ggccggcagg       360
     ttcctgaccc ccgagctgcg caaccagatg cgggctgccc ttccgtcctg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page