(data stored in ACNUC7421 zone)

EMBL: CP000820.PE388

CP000820.PE388       Location/Qualifiers
FT   CDS_pept        469212..469604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0391"
FT                   /product="protein of unknown function DUF742"
FT                   /note="PFAM: protein of unknown function DUF742; KEGG:
FT                   fal:FRAAL4395 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09857"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFB2"
FT                   /protein_id="ABW09857.1"
FT                   /translation="MAGDWSGSTGLGDSWDESEPLVRPYAVTRGRTAPAVPLELVALVA
FT                   TTDSGMAAIRRRGRLAPEEHDIAILCMRIHSIAEISARLKLPLMVVRVLIDDMARDGMV
FT                   SVHRPENPDRPSPELLRRVLHGLTRL"
     gtggctggcg actggtccgg gtcaacagga ctgggcgata gctgggatga gtccgagccg        60
     ctggtccgtc cctacgcggt gaccaggggg cgcaccgcgc ccgccgtccc gctggagctc       120
     gtcgcgctgg tcgcgacgac cgattcggga atggcggcga tccggcggcg cggccggctc       180
     gcccccgagg aacacgacat cgcgatcctg tgcatgcgaa tccactcgat tgccgagatc       240
     tccgccaggc tcaagctgcc gctgatggtg gttcgggtcc tcatcgacga catggcgcgc       300
     gacggaatgg tctccgtcca ccgccccgaa aatccagatc ggcccagtcc ggaactccta       360
     cggagggttc tgcatggtct cacccgtctc taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page