(data stored in ACNUC7421 zone)

EMBL: CP000820.PE39

CP000820.PE39        Location/Qualifiers
FT   CDS_pept        47146..48660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0040"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_2905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09508"
FT                   /db_xref="GOA:A8LB47"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB47"
FT                   /protein_id="ABW09508.1"
FT                   /translation="MTARTGRYTAEQYERWHIRVCARCGRRASLSANWSDGPICRSCYD
FT                   RAARTYGRCPGCQAERLLPGRDDDGAALCRDCAGITRDFFCSRCGFEGLLLGGRLCERC
FT                   TLTDQLAAALDDGTGNVSPPLVPLLDALRVMPKPKSGLAWLRNPRVRELLADLATGRVA
FT                   LTHEALHALPNWRTVAYLRDLLMACGVLPAVDKQLLHHETWLHRQLAELDGHPHARLLR
FT                   QFGTWAQLPRLRHRAAARPLTPHARKEAAAQFTQARLFLAWLDERDRTPETLTRTDVDV
FT                   WHATHLDHAKRSLRTFLTWAMDSGHLPCLDLPRLQIVRAEPLTQRRRLDLVKSVLTSET
FT                   GSPPTRAAACLMLLYAQPASRIVRLTVDDLTRDGDQVLLRLGDPPVPVPDPFATLLLTA
FT                   ATRRDNMTTATNPDSRWLFPGRRAGQPLHPCSLLDQIRALGIPIQAARTAALRQLVLQA
FT                   PAPVVAQALGYHPITTQWHRADAGGTWTHYAPGDHAGPSPTPPVIT"
     gtgacggccc ggaccggccg ctacaccgct gagcagtacg aacgctggca catccgcgtc        60
     tgcgcgcgct gcgggcggcg ggcgtcccta tcggcgaact ggtcggacgg gccgatctgc       120
     cgcagctgct acgaccgggc cgcccgcacc tacggtcgct gccccggttg ccaggccgaa       180
     cggctccttc ccggccgcga cgacgacggg gccgccctct gcagggactg cgccggcatc       240
     acccgcgact tcttctgctc ccggtgcggt ttcgagggcc tgctgctcgg cggccggctc       300
     tgcgaacgct gcaccctcac cgaccagctc gctgccgccc tcgacgacgg caccgggaac       360
     gtcagcccgc cgctggtgcc gctgctcgac gcgctgcgcg tgatgccgaa gccgaagtcc       420
     ggcctggcct ggctgcgcaa cccccgagtc cgtgaactgc tcgcggacct ggccacgggg       480
     cgcgtcgcgc tgacgcacga ggccctgcac gcgctgccga actggcggac cgtcgcctac       540
     ctgcgggacc tgctgatggc ctgcggcgtg ctacccgccg tcgacaagca gctgctgcac       600
     cacgagacct ggctgcaccg ccagctggcc gagctcgacg gccaccccca cgcccggctg       660
     ctgcgccagt tcggcacgtg ggcgcagctg ccgcggcttc gccaccgggc ggcggcgcgc       720
     ccgctgaccc cgcacgcccg caaggaggcg gccgcgcagt ttacccaggc ccggctgttc       780
     ctggcctggc tcgacgagcg cgaccggaca ccggaaacgc tcacccggac cgacgtcgat       840
     gtctggcacg ccacccacct cgaccacgcg aaacgctccc tgcggacgtt cctgacctgg       900
     gcgatggaca gcggccatct gccctgcctc gaccttcccc gcctccagat cgtccgcgcg       960
     gagcctctca cccagcggcg ccgcctcgac ctggtgaaat ccgtcctgac cagcgagacc      1020
     ggctcgccgc cgacccgcgc cgcggcctgc ctgatgctgc tctacgccca gcccgccagc      1080
     cgcatcgtgc gcctcaccgt cgacgacctc acccgcgacg gcgaccaggt cctgctccgg      1140
     ctcggcgacc cgcccgtccc ggttcccgac ccgttcgcca cgctcctgct gaccgccgca      1200
     acccggcggg acaacatgac caccgccacg aacccggaca gccgctggct gttccccggc      1260
     cgccgcgccg gccagcccct gcacccctgc agcctgctcg accagatccg cgccctcggc      1320
     atcccgatcc aggccgcccg caccgccgcg ctacgccagc tcgtcctgca agcccccgcc      1380
     ccggtcgtcg cccaggccct cggctaccac ccgatcacca cccagtggca ccgcgccgac      1440
     gccggcggca cctggaccca ctacgccccc ggcgatcacg ccgggccgag ccccacgccg      1500
     ccggtcatca cgtga                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page