(data stored in ACNUC7421 zone)

EMBL: CP000820.PE391

CP000820.PE391       Location/Qualifiers
FT   CDS_pept        470606..471238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_1321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09860"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFB5"
FT                   /protein_id="ABW09860.1"
FT                   /translation="MTLLLLTTEAAVVFGVSTYLLLRTWTRYRAVTMADVFFYDHADGA
FT                   RLPCSRSAGPRVLGEHVVAGFERSPLGAVIAAINLAHRATSTVGAAGVGGVGGVGGFGG
FT                   AAGAVGGKPVPGGGNGPSGTSWYQVQIIGWEVERYSSRKAAIRYLLTRSVDGGDAVTTT
FT                   MRVEVSWVGADWRVVDPPSGDWTHAFFLGDDVSGFSCFPSEFRFPVP"
     atgaccctcc tcctgctgac gaccgaggcc gcggtcgtct tcggggtgtc cacctacctg        60
     ttgctccgca cctggacgag atatcgggcc gtcaccatgg ccgacgtctt cttctatgac       120
     cacgcggacg gcgcgcgcct gccgtgcagc cgttccgccg gtccgcgggt gctgggcgag       180
     cacgtcgtcg cgggattcga gcgctcaccg ttgggtgctg tcatcgccgc gatcaacctt       240
     gcgcaccggg cgacctccac cgtcggcgcc gcgggcgttg ggggcgttgg gggcgttggc       300
     ggttttgggg gtgcagccgg cgcggtcggc ggaaagcccg tcccgggggg tgggaacggg       360
     ccgagtggta cctcctggta ccaggtgcag atcatcggat gggaagtcga gcgctattcg       420
     tccaggaaag cggcgattcg atacctcctc acccgttctg tggacggcgg cgacgcggtc       480
     acgacgacga tgcgggttga ggtgagctgg gtcggcgccg actggcgtgt ggtcgatccg       540
     ccctcggggg actggacaca cgcattcttc ctgggtgacg atgtctccgg tttcagttgc       600
     tttccgtcgg agttccgctt cccagtcccg taa                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page