(data stored in ACNUC7421 zone)

EMBL: CP000820.PE393

CP000820.PE393       Location/Qualifiers
FT   CDS_pept        472073..472792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0396"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1508 hypothetical protein; putative
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09862"
FT                   /db_xref="GOA:A8LGC3"
FT                   /db_xref="InterPro:IPR021737"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGC3"
FT                   /protein_id="ABW09862.1"
FT                   /translation="MWRVSESMDSLTRHSFVIGVFPGHAGAGLLPYPWRMFRNFEGAHP
FT                   ARCRCSPGRGWDARAAGCPGHQPGASQIAASGPKSRSSAVVCPTVISAGGGTSMTDAMV
FT                   FCAAFIALFTGHHLGDHVAQTDRQATEKDGRGWPAARAMTGHLFAYHLCVAAALASLLI
FT                   IDVPLRLPGVIAALGWSIVTHGFIDRRWPVRWLLRRSGAARFAELKSSGLNGMYLADQS
FT                   LHIGCLFIGALLAAGLS"
     gtgtggcggg tgagtgagtc catggactca ctcacccgcc acagttttgt gatcggggtg        60
     ttcccgggcc atgcgggagc ggggcttttg ccctatccat ggcggatgtt ccgaaatttc       120
     gagggcgcgc atccggcccg gtgtcgttgt tctcctggcc gggggtggga cgcgcgagcg       180
     gctggctgcc cggggcacca gcctggggcg tcgcaaatcg ccgcttccgg tccgaagtcc       240
     cgatcttctg ccgtggtgtg ccctactgtt atttcggcgg gagggggcac gtcgatgact       300
     gatgccatgg tgttctgtgc cgcgttcatt gctttattta cgggccatca cctaggtgat       360
     catgtcgcgc agacggatcg acaggcgacc gagaaggacg ggcgcggatg gcccgccgcc       420
     cgcgccatga ccggtcatct attcgcttac catctgtgcg tcgctgcggc cctggcgagt       480
     ctcctgatta tcgacgtacc actgcgtctt ccgggcgtga tagccgcgct gggctggtcc       540
     atcgtcacgc acgggtttat cgaccgtagg tggccggtac gctggctgct gcgccgatcg       600
     ggagcggccc gattcgccga gctgaaaagc agcggcctca acggaatgta cctggccgat       660
     cagtcactac atattggatg tctgttcatt ggtgcccttc tggctgcggg cctgagctga       720
//

If you have problems or comments...

PBIL Back to PBIL home page