(data stored in ACNUC7421 zone)

EMBL: CP000820.PE397

CP000820.PE397       Location/Qualifiers
FT   CDS_pept        479870..480388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_3973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09866"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGC7"
FT                   /protein_id="ABW09866.1"
FT                   /translation="MGGDGARQQGLFDVAGEVTAAEPVLMALHAEYYELIWQGLKTHEF
FT                   RRRFLEGRPVRWFVYLNAPVSRLAAVIDLGPAVVDVPERVAAIAERARVGNGASVLEYV
FT                   RDLERAFAIPILGVSEYSGRSVEELRAELGGFHPPQGYVRLRQHPQLLTVCEKITTESP
FT                   LREMSVHHH"
     atgggcgggg acggcgcgcg gcagcagggt ctgttcgacg tcgccggtga ggtgacggcc        60
     gccgagccgg tgttgatggc gttgcacgcc gagtactacg agctgatctg gcaggggttg       120
     aagacgcacg agttccggcg ccggttcctg gagggtcgtc cggttcgctg gtttgtgtac       180
     ctgaacgcgc cggtgtcgcg gctggcggcg gtcatcgatc tgggaccggc ggtggtggat       240
     gtgccggagc gggtcgcggc gatcgcggag cgggcccggg tgggtaacgg cgcgagcgtg       300
     ttggagtacg tgcgggacct ggagcgggcc ttcgcgattc cgatcttggg tgtttccgag       360
     tactcgggcc ggtcggtgga ggagctgcgg gccgagctgg gcgggttcca tccgccgcag       420
     ggttatgtcc ggttgcggca gcatccgcag ctgttgacgg tgtgcgagaa aatcaccacg       480
     gagagcccgc tgcgggagat gtccgtgcat catcactga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page