(data stored in ACNUC7421 zone)

EMBL: CP000820.PE399

CP000820.PE399       Location/Qualifiers
FT   CDS_pept        complement(480893..481999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0402"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   stp:Strop_4141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09868"
FT                   /db_xref="GOA:A8LGC9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGC9"
FT                   /protein_id="ABW09868.1"
FT                   /translation="MSAGRDPCRAGWMVMVWSLLYALTRNTLGLMLLRVRGDAAKDVEL
FT                   LVLRHQVAVLRRRVHRPALEPADRVILAALSRLLPRASWDIFFVTPATVLRWHRELLAR
FT                   KWTYPRKTHGRPPIRREIRELVLRLARENPTWGHRRIQGELVGLGYSVGVATVWRILHR
FT                   AGVDPAPRRADTSWRTFLRAQASGILACDFFTVDTVFLQRIYVFFVVEHATRRVHVLGV
FT                   TKHPTTAWVTQQARNLLIDLEERSHRFRFLLRDRDTKFTSSFDAVFTGAGIDVVRTPPQ
FT                   APQANAIAERWVGTARRECTDRLLIVSERHLTSVLDSYAEHFNTHRPHRSLGQHPPDSP
FT                   PVVAPTSESTVRRTRILGGLINEYRNAA"
     ttgtcagcgg ggcgggaccc gtgtcgggca ggctggatgg tcatggtgtg gtcgctgctc        60
     tacgccctga cacgcaacac tctcgggctg atgctgctcc gcgtgcgcgg ggatgctgcg       120
     aaggacgtcg aactcctcgt cctgcggcac caggtggcgg tgttgcgacg gcgggtccat       180
     cgtccggcat tggaaccggc ggatcgggtg attctcgcag ccctgtcccg gctgctaccc       240
     cgggccagtt gggacatctt cttcgtcacc ccggccaccg tgctgcgctg gcaccgtgag       300
     ctcctcgcac gaaaatggac ttacccgcgc aagacgcacg gacggccgcc gatccgccgg       360
     gagatccgtg agctggttct gcgtctcgcg cgggagaacc cgacctgggg ccaccgcagg       420
     atccagggcg agctcgtcgg gttgggttac tcggtcgggg tcgccaccgt ctggcggatt       480
     ctgcaccgcg ccggcgtcga ccccgcacct cggcgggccg acacctcctg gcgcacgttc       540
     ctacgcgccc aggcctccgg catcctggcc tgcgacttct tcaccgtgga caccgtgttc       600
     ctccaacgga tctacgtgtt cttcgtcgtc gaacacgcca cccgccgtgt tcatgtcctc       660
     ggggtcacga agcacccgac cacggcgtgg gtcacccagc aggcacggaa cctgctaata       720
     gatctcgagg agcgcagcca ccggttccgg ttccttctcc gtgaccgtga cacgaagttc       780
     acgtcctcgt tcgacgctgt cttcactggg gccggtatcg acgtggtgcg cacaccaccg       840
     caagccccgc aggcgaacgc gatcgcggaa cgctgggtcg gcaccgcccg ccgggaatgt       900
     accgacaggc tgttgatcgt ctccgaacgg cacctgacgt cagtcctcga cagctacgcc       960
     gagcatttca acacccaccg gccccaccgc tccctcggcc agcacccacc cgactcgcca      1020
     cccgtggtcg ccccgacgtc ggagtccacc gtccgtcgca cacgcatcct cggcgggctg      1080
     atcaacgagt accgcaacgc cgcctga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page