(data stored in ACNUC7421 zone)

EMBL: CP000820.PE4

CP000820.PE4         Location/Qualifiers
FT   CDS_pept        5118..6491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: sen:SACE_0005 DNA
FT                   replication and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09473"
FT                   /db_xref="GOA:A8LB19"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB19"
FT                   /protein_id="ABW09473.1"
FT                   /translation="MHLTHLSLTDFRSYARLDLVLEPGVTTFVGSNGQGKTNLIEAIGF
FT                   VATLGSHRVANDAPLVREGCGQAVVRARIVRGDRAALVEMQIVPGKANRVRLNRAPVAR
FT                   ARDVAGLLATVLFAPEDLALVKGDPAERRRFLDDLLVARAPRMAAVQSDYDRVLKQRSA
FT                   LLRSAGAARRAGGRGDLRTLDVWDRHLADHGAELLAARLALVEELRPRVESAYAAVAGQ
FT                   DAPTGIEYRSTVTLDSSPDRALSPGRAGLGEPDGDAGRNGNGASPNHPSGSGDPASGNG
FT                   GSGDTEVGDTEAGRTGDGAGDGRTEADRTEVGHVGGAVGGTATRAALEEAILAGLAAVR
FT                   TQEIERGVTLVGPHRDDLLLSVNGRPARGYASHGESWSLALALRLASFELLRADDREPV
FT                   LLLDDVFAELDTRRRARLAALVADAEQVLVTAAVDADVPAELAGVRFEVVSGEVCRAG"
     gtgcatctca cccacctgtc cctgaccgac ttccgctcgt acgcccggct ggacctcgtc        60
     ctcgagccag gtgtcacgac gttcgtgggt tcgaacggtc agggcaagac gaacctgatc       120
     gaagcgatcg gattcgtcgc cacgttgggt agccatcgtg tcgcgaacga tgctccgctc       180
     gtccgcgagg ggtgcgggca ggctgttgtt cgggcccgga tcgtgcgcgg tgaccgggcc       240
     gcgctggtcg agatgcagat cgtgcccggg aaggcgaaca gggtccgcct gaaccgtgcc       300
     ccagtggccc gggcccgcga cgtggcggga ctgctcgcca cggtcctctt cgccccggag       360
     gacctcgcgc tggtgaaggg cgacccggcc gagcggcggc ggttcctcga cgacctgctg       420
     gtcgcgcggg cgccgcggat ggcggcggtg cagtccgact acgaccgggt gctcaagcag       480
     cgctcggcgc tcctgcggtc ggcgggagcc gcccgccgtg ccggtggccg gggcgacctg       540
     cgcacgctcg acgtctggga caggcatctc gccgaccacg gcgcggagct gctcgcggcc       600
     cgcctggcgc tggtcgagga gttgcggccg cgggtcgaga gcgcctacgc cgcggtcgcg       660
     ggccaggacg cgcccaccgg catcgagtac cgctcgaccg tgacgctcga ttcgtcaccc       720
     gatcgggcct tgtcgccagg ccgggctggc ctgggcgagc cggacgggga cgccggccgg       780
     aacggaaacg gcgccagccc gaatcacccg agtggctcgg gtgaccccgc gagcgggaac       840
     ggcggttcgg gcgacaccga ggttggcgac accgaggctg gccgcacggg tgatggcgcg       900
     ggtgacggtc gcacggaagc cgaccgcaca gaggttggcc atgtgggagg tgccgtcggc       960
     ggcacggcga ctcgggcggc gctcgaagag gcgatcctcg ccggtctcgc ggcggtgcgc      1020
     acccaggaga tcgagcgcgg tgtgacgctg gtcggtccac atcgtgacga tctgctgttg      1080
     tcagtgaacg ggcggccggc gcgtggctat gccagccacg gcgagtcctg gtcgctggcg      1140
     ctcgcgctgc ggctggcctc gttcgaactg ctccgcgcgg acgaccggga accggtgctg      1200
     ctgctcgacg acgtgttcgc ggagctggac acccgccggc gcgcgcggct cgccgccctg      1260
     gtcgctgacg ccgagcaggt actcgtgacc gcggcggtcg acgcggatgt gccggcggag      1320
     cttgccggtg tgcgcttcga ggtggtctcc ggggaggtgt gccgtgccgg ctga            1374
//

If you have problems or comments...

PBIL Back to PBIL home page