(data stored in ACNUC7421 zone)

EMBL: CP000820.PE401

CP000820.PE401       Location/Qualifiers
FT   CDS_pept        complement(482764..483234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0404"
FT                   /product="67-dimethyl-8-ribityllumazine synthase"
FT                   /note="PFAM: 67-dimethyl-8-ribityllumazine synthase; KEGG:
FT                   nfa:nfa16640 putative riboflavin synthase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09870"
FT                   /db_xref="GOA:A8LGD1"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGD1"
FT                   /protein_id="ABW09870.1"
FT                   /translation="MPSTPTGARPDTVRVAIVAARWHADIVGQAVASFRSALAERGVGE
FT                   VDEYQVPGAFEIPLHTRRLALTGRYDAIATCAFVVDGGIYRHDFVAGTVVDALMRVQLD
FT                   TDVPVFSAVLTPQAFHEHAEHQEFFARHFQVKGRELADAVVTTIAGLAALPA"
     gtgccgtcca ctccgaccgg ggcccgtccc gacaccgtcc gcgtcgcgat cgtcgcggcg        60
     cgctggcacg ccgacatcgt cgggcaggcc gtcgccagct tccgctcggc tctcgccgag       120
     cggggcgtcg gcgaggtcga cgagtaccag gtgccagggg cgttcgagat cccgctgcac       180
     acgcgcaggc tcgcgctcac cggacgctac gacgccatcg ccacctgcgc gttcgtggtg       240
     gacggcggca tctatcggca cgacttcgtc gccggcactg tggtcgacgc gctgatgcgc       300
     gtgcaactgg acacggacgt gcccgtgttc tccgcggtgc tgaccccaca ggccttccac       360
     gagcacgccg agcaccagga gttcttcgcc cggcacttcc aggtcaaggg gcgcgaactc       420
     gccgacgccg tcgtgacgac catcgccggc ctggcggccc tgcccgcgta g                471
//

If you have problems or comments...

PBIL Back to PBIL home page