(data stored in ACNUC7421 zone)

EMBL: CP000820.PE404

CP000820.PE404       Location/Qualifiers
FT   CDS_pept        485352..486323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0407"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: rle:RL2718 putative transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09873"
FT                   /db_xref="GOA:A8LGD4"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGD4"
FT                   /protein_id="ABW09873.1"
FT                   /translation="MSTVAPPGVDAPTFDCRVDFAAELAALARVDERIVAVCNDSVGSS
FT                   NLGAFRDEFPDRLINVGIAEQDLVGVGAGLANAGMVPFVCAAAPFLTGRATEQIKADVA
FT                   YSERHVVLCGHSPGMAYGELGPTHHSIEDLAWMRAVAGLTIAVPADPAQTRAAVLWAAG
FT                   YGRPVYLRIPRFKVPEVSRQGDPFLPGRAVLLREGSDVTLAAVGSMVSRAIWAAQILAD
FT                   DGISARVLNMTFVEPIDRDALISAAEQTAGIVTVEEATTSGGLGAAVAAVVGQTRPCPL
FT                   RILGVPRQFAPTGSTQFLLDHFGLNADGIVGAAREVVGGTRA"
     atgagtaccg tcgcgccgcc gggcgtggac gctccgacgt tcgactgccg cgtggacttc        60
     gccgccgagc tcgcggccct ggcccgcgtc gacgaacgga tcgtcgccgt ctgcaacgac       120
     tcggtggggt cgagcaacct cggcgcgttc cgcgacgagt tcccggaccg gctgatcaac       180
     gtcgggatcg ccgagcagga cctcgtcggt gtcggggccg ggctcgcgaa cgcgggaatg       240
     gtgcccttcg tctgcgccgc ggcgcccttc ctgacaggac gagccaccga acagatcaag       300
     gccgacgtcg cctacagcga acggcacgtc gtcctgtgcg ggcacagccc cggcatggcc       360
     tacggcgagc tcggcccgac gcaccactcg atcgaggacc tcgcctggat gcgcgcggtc       420
     gccgggctga cgatcgccgt cccggccgac ccggcacaga ccagggccgc ggtgctctgg       480
     gccgccggct acggccgtcc ggtctacctg cgcataccgc gtttcaaggt acccgaggtg       540
     tcgcgacagg gtgatccgtt cctgcccggc cgggccgtcc tgctgcgcga gggctccgac       600
     gtgaccctcg ccgccgtcgg ctccatggtc tcccgagcga tctgggccgc gcagattctg       660
     gctgacgacg gtatctccgc ccgggtgctc aacatgacgt tcgtcgagcc gatcgaccgg       720
     gacgcgctca tcagcgccgc cgagcagacc gccggcatcg tcaccgtcga ggaggccacc       780
     accagcggcg ggctcggcgc ggcggtcgcc gccgtcgtgg ggcagacgcg cccctgcccg       840
     ctgcgtatcc tcggcgttcc tcgccagttc gcccccactg ggagtaccca gttcctgctg       900
     gaccacttcg gtctcaacgc ggacggcatc gtgggcgcgg cccgagaggt ggtcggtggc       960
     acccgcgcgt ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page