(data stored in ACNUC7421 zone)

EMBL: CP000820.PE409

CP000820.PE409       Location/Qualifiers
FT   CDS_pept        complement(489800..489934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09878"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGD9"
FT                   /protein_id="ABW09878.1"
FT                   /translation="MRFPNVWFGDLRGNQVSPGHTLTGSMAGFTVALSWDLQPDRRSS"
     gtgcgcttcc cgaacgtgtg gttcggcgac cttcgtggca atcaggtcag tcccgggcac        60
     accctcaccg gcagcatggc cggcttcacc gtggcgctca gctgggacct ccagccggac       120
     agaagatcat cgtga                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page