(data stored in ACNUC7421 zone)

EMBL: CP000820.PE410

CP000820.PE410       Location/Qualifiers
FT   CDS_pept        complement(489966..490472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09879"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGE0"
FT                   /protein_id="ABW09879.1"
FT                   /translation="MAEIANFLPLPSQLWVTDDTPGLARLHPARRRCLRRQPGRGLPRR
FT                   LRQRDRRYEVLGRFDPTRRPAQLNIELHRGTKVTPPNMVNNTDLTPLASITDLDLQIAA
FT                   DGSFRITIGLERSPVHLLSTPGLLSLGSRDMLTSWDQRPSWMELRPLDDTEPAPFDLTK
FT                   IVEAV"
     atggccgaga tcgcgaactt cctgccgctt ccctcccagc tctgggtcac cgacgacacc        60
     ccgggactgg ctcggctaca ccctgcccgg cgtcggtgcc tccggcgaca gcccggacgc       120
     ggtctaccgc gtcgcctccg tcaacgggac cggcgctacg aggtgctcgg ccgcttcgac       180
     cccacccgcc gccccgcgca gctcaacatc gagctgcacc gcggaaccaa ggtcactccg       240
     ccgaacatgg tcaacaacac ggacctgacc ccgctcgcca gtatcaccga cctcgatctg       300
     cagatcgcgg cggatggttc gttccgcatc acgatcggcc tggagaggag ccccgtccat       360
     ctgctgtcga ctcccggcct gctttccctc ggctcccggg acatgctgac cagctgggat       420
     cagcgcccgt cctggatgga gctgcgcccg ctcgacgaca cagagccggc ccccttcgac       480
     ctcacgaaga tcgtggaggc ggtgtag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page