(data stored in ACNUC7421 zone)

EMBL: CP000820.PE411

CP000820.PE411       Location/Qualifiers
FT   CDS_pept        491787..492062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0415"
FT                   /product="luciferase family protein"
FT                   /note="KEGG: mkm:Mkms_5022 luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09880"
FT                   /db_xref="GOA:A8LGE1"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGE1"
FT                   /protein_id="ABW09880.1"
FT                   /translation="MHDDLAEARAATAATATVYESLPNYQRILEIGGAESATDAAVLGD
FT                   EEGVTRQLRGLLDAGATDIQAFVVPVGPDRRGSRRRTTGLLASLTA"
     gtgcacgatg accttgcgga agcccgggcg gcgacggccg cgacggcgac cgtgtacgag        60
     agcctgccca actatcagcg aatcctcgag atcggcgggg cggaaagcgc gaccgacgcg       120
     gccgtcctcg gcgacgagga gggtgtcacg cgccagctgc gcggcctgct cgacgcgggg       180
     gcgaccgaca tccaggcctt cgtcgtacct gtcggacctg accgccgggg gtcgcggcga       240
     cgtacaacgg gcctcctcgc ttcactcacc gcctga                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page