(data stored in ACNUC7421 zone)

EMBL: CP000820.PE413

CP000820.PE413       Location/Qualifiers
FT   CDS_pept        492279..493022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0417"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: acr:Acry_2115 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09882"
FT                   /db_xref="GOA:A8LGE3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGE3"
FT                   /protein_id="ABW09882.1"
FT                   /translation="MKVFENRVAVVTGAASGIGLAVARRLAAMGVRLVMTDLDGGAVVA
FT                   AGAAVRSDGCDVEAVQLDVRDPGAVERVADLAIDRFGALHVAVNNAGIVNRGLAWELSL
FT                   EDWRRVLDVNLLGAIHGVRSFVPRILATGEEGHVVNVASMAAVLPQERLGPYTVAKHGV
FT                   LGLSDVLRADLAAVGAPVGVSVVFPGRIRTGMNPIGTVEPSTVADHVVDAIERQRPYVF
FT                   TDDHSVGGVEARLQAILAARADVIT"
     atgaaggtgt tcgagaaccg tgtcgccgtc gtgacgggcg cggcgagtgg catcggcctg        60
     gccgtcgcgc ggcgtcttgc cgcgatgggt gtccggctgg tgatgacgga tcttgatggt       120
     ggtgcggtgg tggcggccgg tgcggccgtc cggagcgatg gctgcgatgt cgaggcagtg       180
     cagctcgacg tccgcgaccc cggggcggtc gagcgcgtgg ccgacctggc catcgaccgg       240
     ttcggcgcgc tccacgtcgc agtgaacaat gccgggatcg tgaaccgggg cctcgcttgg       300
     gagctttccc tcgaggactg gcgccgtgtg ttggacgtga acctcctcgg tgccatccac       360
     ggggtgcggt cgttcgtgcc gaggatcctc gcaaccggcg aggagggcca cgtcgtgaac       420
     gtggcgtcga tggccgccgt cctcccccag gagcgcctcg ggccttacac cgtcgcgaag       480
     cacggtgtcc tcggcctctc cgacgtcctg cgtgccgacc tcgccgcggt cggagcgccg       540
     gtcggtgtca gcgtggtctt tcccggccgc atccgcacgg gcatgaaccc gatcggcacc       600
     gtcgagcctt caaccgtcgc cgaccacgtc gtcgacgcga tcgaacggca acgaccctac       660
     gtcttcaccg acgaccactc ggtcggcggc gtcgaggcgc gtcttcaggc tattctcgcg       720
     gcccgcgcgg atgtcatcac ctga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page